SitesBLAST
Comparing RR42_RS05540 FitnessBrowser__Cup4G11:RR42_RS05540 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7arcG Cryo-em structure of polytomella complex-i (peripheral arm) (see paper)
37% identity, 80% coverage: 2:632/792 of query aligns to 6:596/682 of 7arcG
- binding fe2/s2 (inorganic) cluster: R36 (≠ H32), C38 (= C34), Y39 (= Y35), G47 (≠ A43), C49 (= C45), R50 (= R46), C52 (= C48), C66 (= C62)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), Q107 (= Q103), C111 (= C107), Q114 (= Q110), C150 (= C147), I151 (= I148), C153 (= C150), C156 (= C153), C200 (= C197), V202 (= V199), A204 (= A201), L205 (= L202)
- binding : K272 (≠ N269), Q274 (≠ D272), R275 (= R273), N277 (≠ T275), G539 (≠ S575), L579 (= L615)
7qsoG Bovine complex i in lipid nanodisc, state 3 (slack) (see paper)
36% identity, 87% coverage: 1:691/792 of query aligns to 4:658/700 of 7qsoG
- binding fe2/s2 (inorganic) cluster: R35 (≠ H32), C37 (= C34), Y38 (= Y35), G46 (≠ A43), C48 (= C45), R49 (= R46), C51 (= C48), C65 (= C62)
- binding iron/sulfur cluster: H97 (= H94), D100 (= D97), C101 (= C98), C104 (= C101), Q106 (= Q103), G107 (= G104), C110 (= C107), Q113 (= Q110), C149 (= C147), I150 (= I148), Q151 (≠ H149), C152 (= C150), T153 (= T151), R154 (= R152), C155 (= C153), C199 (= C197), P200 (= P198), V201 (= V199), G202 (= G200), A203 (= A201)
7a23C Plant mitochondrial respiratory complex i (see paper)
37% identity, 83% coverage: 2:658/792 of query aligns to 25:638/693 of 7a23C
- binding fe2/s2 (inorganic) cluster: R55 (≠ H32), C57 (= C34), Y58 (= Y35), C68 (= C45), C71 (= C48), C85 (= C62)
- binding iron/sulfur cluster: H117 (= H94), D120 (= D97), C121 (= C98), C124 (= C101), G127 (= G104), C130 (= C107), L132 (= L109), Q133 (= Q110), C169 (= C147), I170 (= I148), Q171 (≠ H149), C172 (= C150), T173 (= T151), R174 (= R152), C175 (= C153), I199 (= I177), C219 (= C197), P220 (= P198), V221 (= V199), G222 (= G200)
8bedG Cryo-em structure of the arabidopsis thaliana i+iii2 supercomplex (ci peripheral tip) (see paper)
37% identity, 83% coverage: 2:658/792 of query aligns to 18:631/687 of 8bedG
- binding fe2/s2 (inorganic) cluster: R48 (≠ H32), C50 (= C34), Y51 (= Y35), G59 (≠ A43), C61 (= C45), R62 (= R46), C64 (= C48), C78 (= C62)
- binding iron/sulfur cluster: H110 (= H94), D113 (= D97), C114 (= C98), C117 (= C101), Q119 (= Q103), G120 (= G104), C123 (= C107), L125 (= L109), Q126 (= Q110), C162 (= C147), I163 (= I148), Q164 (≠ H149), C165 (= C150), T166 (= T151), C168 (= C153), I192 (= I177), C212 (= C197), V214 (= V199), A216 (= A201), L217 (= L202)
- binding : I116 (= I100), F224 (≠ Y209), W305 (= W290), R306 (≠ Q291), P589 (≠ R613), T590 (≠ A614), R595 (= R619), D596 (≠ P620), K599 (= K623), I600 (≠ V624), R602 (= R626), A603 (≠ V627), E606 (≠ N630)
7zm7A Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
37% identity, 82% coverage: 2:649/792 of query aligns to 3:617/711 of 7zm7A
- binding fe2/s2 (inorganic) cluster: R33 (≠ H32), C35 (= C34), Y36 (= Y35), G44 (≠ A43), C46 (= C45), R47 (= R46), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), D98 (= D97), C99 (= C98), C102 (= C101), Q104 (= Q103), G105 (= G104), C108 (= C107), Q111 (= Q110), C149 (= C147), I150 (= I148), C152 (= C150), T153 (= T151), C155 (= C153), I179 (= I177), C199 (= C197), V201 (= V199), L204 (= L202)
7v2cM Active state complex i from q10 dataset (see paper)
35% identity, 87% coverage: 1:691/792 of query aligns to 3:657/690 of 7v2cM
- binding fe2/s2 (inorganic) cluster: C36 (= C34), Y37 (= Y35), G45 (≠ A43), C47 (= C45), R48 (= R46), C50 (= C48), C64 (= C62)
- binding magnesium ion: Q105 (= Q103), C198 (= C197), V200 (= V199)
- binding iron/sulfur cluster: H96 (= H94), D99 (= D97), C100 (= C98), C103 (= C101), Q105 (= Q103), C109 (= C107), Q112 (= Q110), C148 (= C147), C151 (= C150), T152 (= T151), R153 (= R152), C154 (= C153), C198 (= C197), V200 (= V199), A202 (= A201), L203 (= L202)
5gupG structure of mammalian respiratory supercomplex I1III2IV1 (see paper)
36% identity, 87% coverage: 1:691/792 of query aligns to 2:642/673 of 5gupG
- binding fe2/s2 (inorganic) cluster: C35 (= C34), Y36 (= Y35), N45 (= N44), C46 (= C45), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), C99 (= C98), C102 (= C101), Q104 (= Q103), C108 (= C107), Q111 (= Q110), R146 (= R146), C147 (= C147), I148 (= I148), C150 (= C150), T151 (= T151), C153 (= C153), V177 (≠ I177), C197 (= C197), P198 (= P198), A201 (= A201), L202 (= L202)
- binding : K269 (≠ N269), R270 (≠ S270), Q271 (≠ D272), R272 (= R273), R279 (≠ K280), L284 (≠ E284), L285 (≠ W285), Y287 (≠ E287)
7b0nG 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
35% identity, 83% coverage: 2:658/792 of query aligns to 3:622/694 of 7b0nG
- binding fe2/s2 (inorganic) cluster: C35 (= C34), G44 (≠ A43), C46 (= C45), R47 (= R46), C49 (= C48), C63 (= C62)
- binding iron/sulfur cluster: H95 (= H94), C99 (= C98), C102 (= C101), C108 (= C107), Q111 (= Q110), C149 (= C147), H151 (= H149), C152 (= C150), T153 (= T151), C155 (= C153), C199 (= C197), V201 (= V199)
8gyms1 NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial (see paper)
35% identity, 83% coverage: 2:658/792 of query aligns to 4:618/689 of 8gyms1
- binding fe2/s2 (inorganic) cluster: R34 (≠ H32), C36 (= C34), Y37 (= Y35), C47 (= C45), C50 (= C48), C64 (= C62)
- binding iron/sulfur cluster: H96 (= H94), C100 (= C98), C103 (= C101), Q105 (= Q103), G106 (= G104), C109 (= C107), Q112 (= Q110), R147 (= R146), C148 (= C147), I149 (= I148), H150 (= H149), C151 (= C150), T152 (= T151), R153 (= R152), C154 (= C153), C198 (= C197), P199 (= P198), V200 (= V199), G201 (= G200), A202 (= A201)
8eszS1 NADH-ubiquinone oxidoreductase chain 1 (see paper)
37% identity, 83% coverage: 2:658/792 of query aligns to 4:621/683 of 8eszS1
- binding fe2/s2 (inorganic) cluster: C36 (= C34), Y37 (= Y35), A44 (= A42), G45 (≠ A43), C47 (= C45), R48 (= R46), C50 (= C48), C64 (= C62)
- binding iron/sulfur cluster: H96 (= H94), D99 (= D97), C100 (= C98), C103 (= C101), C109 (= C107), Q112 (= Q110), C152 (= C147), I153 (= I148), H154 (= H149), C155 (= C150), T156 (= T151), R157 (= R152), C158 (= C153), I182 (= I177), C202 (= C197), P203 (= P198), V204 (= V199)
P29915 NADH-quinone oxidoreductase chain 3; NADH dehydrogenase I, chain 3; NDH-1, chain 3; EC 7.1.1.- from Paracoccus denitrificans (see 2 papers)
37% identity, 79% coverage: 3:628/792 of query aligns to 6:583/673 of P29915
- H106 (= H94) mutation to A: Very little incorporation of iron-sulfur centers into protein in E.coli.; mutation to C: Alters the EPR signal of the N5 cluster; all 3 iron-sulfur clusters are less stable in E.coli.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
6x89S1 radiata mitochondrial complex I* (see paper)
43% identity, 52% coverage: 2:409/792 of query aligns to 19:422/688 of 6x89S1
- binding fe2/s2 (inorganic) cluster: C51 (= C34), G60 (≠ A43), C62 (= C45), R63 (= R46), C65 (= C48), C79 (= C62)
- binding iron/sulfur cluster: H111 (= H94), C115 (= C98), C118 (= C101), C124 (= C107), L126 (= L109), R162 (= R146), C163 (= C147), I164 (= I148), Q165 (≠ H149), C166 (= C150), C169 (= C153), C213 (= C197), P214 (= P198), V215 (= V199), V215 (= V199), G216 (= G200)
- binding : W306 (= W290), R307 (≠ Q291)
Sites not aligning to the query:
8e9hG Mycobacterial respiratory complex i, fully-inserted quinone (see paper)
33% identity, 97% coverage: 1:770/792 of query aligns to 4:776/782 of 8e9hG
- binding fe2/s2 (inorganic) cluster: R35 (≠ H32), C37 (= C34), D38 (≠ Y35), G46 (≠ A43), C48 (= C45), R49 (= R46), C51 (= C48), A63 (≠ P60), C65 (= C62)
- binding guanosine-5'-triphosphate: R320 (≠ H320), R486 (vs. gap), R487 (vs. gap), G554 (≠ E546), E556 (= E548), D559 (= D550), L579 (= L570), E580 (≠ S571), R582 (= R574), D627 (= D617), R689 (≠ P689), G695 (≠ D695), R696 (≠ S696), L697 (= L697)
- binding iron/sulfur cluster: H99 (= H94), D102 (= D97), C103 (= C98), C106 (= C101), G109 (= G104), C112 (= C107), Q115 (= Q110), C152 (= C147), V153 (≠ I148), L154 (≠ H149), C155 (= C150), A156 (≠ T151), R157 (= R152), C158 (= C153), C202 (= C197), P203 (= P198), V204 (= V199), A206 (= A201), L207 (= L202), C228 (≠ S223), C231 (≠ D226), S233 (≠ L228), C235 (≠ A230), N262 (≠ L257), C263 (≠ S258), G266 (≠ D261), P391 (= P385), I392 (≠ L386)
5lc5G Structure of mammalian respiratory complex i, class2 (see paper)
57% identity, 26% coverage: 1:203/792 of query aligns to 1:202/685 of 5lc5G
- binding fe2/s2 (inorganic) cluster: R32 (≠ H32), C34 (= C34), G43 (≠ A43), C45 (= C45), C48 (= C48), C62 (= C62)
- binding iron/sulfur cluster: H94 (= H94), D97 (= D97), C98 (= C98), C101 (= C101), C107 (= C107), Q110 (= Q110), C146 (= C147), I147 (= I148), C149 (= C150), C152 (= C153), C196 (= C197), G199 (= G200)
7nyrG Respiratory complex i from escherichia coli - conformation 1 (see paper)
28% identity, 88% coverage: 1:695/792 of query aligns to 1:718/907 of 7nyrG
- binding calcium ion: D617 (≠ A595), Q632 (≠ G610), E647 (≠ P620)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), W35 (≠ Y35), C45 (= C45), R46 (= R46), C48 (= C48), M65 (≠ P60), C67 (= C62)
- binding iron/sulfur cluster: H99 (= H94), D102 (= D97), C103 (= C98), C106 (= C101), G109 (= G104), C112 (= C107), Q115 (= Q110), C151 (= C147), I152 (= I148), A153 (≠ H149), C154 (= C150), Y155 (≠ T151), C157 (= C153), F181 (≠ I177), C201 (= C197), G204 (= G200), V205 (≠ A201), F206 (≠ L202), C228 (≠ S223), C231 (≠ D226), I233 (≠ L228), C235 (≠ A230), C263 (≠ S258), G266 (≠ D261)
Sites not aligning to the query:
7awtG E. Coli nadh quinone oxidoreductase hydrophilic arm (see paper)
28% identity, 87% coverage: 4:695/792 of query aligns to 3:717/907 of 7awtG
- binding fe2/s2 (inorganic) cluster: Y31 (≠ H32), C33 (= C34), W34 (≠ Y35), G42 (≠ A43), C44 (= C45), R45 (= R46), C47 (= C48), C66 (= C62)
- binding magnesium ion: V197 (≠ I194), C200 (= C197), T202 (≠ V199), D616 (≠ A595), Q631 (≠ G610), E646 (≠ P620)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), C111 (= C107), Q114 (= Q110), C150 (= C147), I151 (= I148), A152 (≠ H149), C153 (= C150), Y154 (≠ T151), C156 (= C153), F180 (≠ I177), C200 (= C197), P201 (= P198), T202 (≠ V199), T202 (≠ V199), G203 (= G200), V204 (≠ A201), C227 (≠ S223), Q229 (≠ H225), C230 (≠ D226), I232 (≠ L228), C234 (≠ A230), C262 (≠ S258), R387 (≠ L386)
Sites not aligning to the query:
3i9vC Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
31% identity, 77% coverage: 1:607/792 of query aligns to 1:602/754 of 3i9vC
- active site: A270 (≠ K260), A353 (vs. gap), A354 (vs. gap), A486 (≠ N477), P514 (≠ E508), A515 (= A509)
- binding calcium ion: D142 (vs. gap), H145 (≠ K133)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (≠ A43), A44 (≠ N44), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding manganese (ii) ion: L251 (≠ V241), D279 (≠ N269)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), K107 (≠ Q103), C111 (= C107), L113 (= L109), Q114 (= Q110), C158 (= C147), I159 (= I148), C161 (= C150), C164 (= C153), F179 (≠ M168), I188 (≠ V181), C207 (= C197), P208 (= P198), V209 (= V199), A211 (= A201), C233 (≠ S223), L235 (≠ H225), C236 (≠ D226), V238 (≠ L228), G239 (= G229), C240 (≠ A230), C268 (≠ S258), G271 (≠ D261), P384 (= P363)
3i9v3 Crystal structure of the hydrophilic domain of respiratory complex i from thermus thermophilus, oxidized, 2 mol/asu (see paper)
31% identity, 77% coverage: 1:607/792 of query aligns to 1:602/754 of 3i9v3
- active site: A353 (vs. gap), A354 (vs. gap), A486 (≠ N477), P514 (≠ E508), A515 (= A509)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (≠ A43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding manganese (ii) ion: L251 (≠ V241), D279 (≠ N269)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), C111 (= C107), Q114 (= Q110), C158 (= C147), I159 (= I148), C161 (= C150), C164 (= C153), F179 (≠ M168), I188 (≠ V181), C207 (= C197), P208 (= P198), V209 (= V199), A211 (= A201), C233 (≠ S223), C236 (≠ D226), V238 (≠ L228), G239 (= G229), C240 (≠ A230), C268 (≠ S258), G271 (≠ D261), P384 (= P363)
2ybb3 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
31% identity, 77% coverage: 1:607/792 of query aligns to 1:602/754 of 2ybb3
- active site: A353 (vs. gap), A354 (vs. gap), A486 (≠ N477), P514 (≠ E508), A515 (= A509)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (≠ A43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding magnesium ion: L251 (≠ V241), D279 (≠ N269)
- binding iron/sulfur cluster: H98 (= H94), C102 (= C98), C105 (= C101), K107 (≠ Q103), C111 (= C107), Q114 (= Q110), C158 (= C147), H160 (= H149), C161 (= C150), C164 (= C153), C207 (= C197), P208 (= P198), V209 (= V199), L212 (= L202), C233 (≠ S223), C236 (≠ D226), V238 (≠ L228), C240 (≠ A230), I267 (≠ L257), C268 (≠ S258), P384 (= P363), I385 (= I364)
4hea3 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
31% identity, 77% coverage: 1:607/792 of query aligns to 1:604/756 of 4hea3
- active site: A355 (vs. gap), A356 (vs. gap), A488 (≠ N477), P516 (≠ E508), A517 (= A509)
- binding fe2/s2 (inorganic) cluster: C34 (= C34), S35 (≠ Y35), G43 (≠ A43), C45 (= C45), R46 (= R46), C48 (= C48), C66 (= C62)
- binding iron/sulfur cluster: H98 (= H94), D101 (= D97), C102 (= C98), C105 (= C101), C111 (= C107), Q114 (= Q110), R159 (= R146), C160 (= C147), I161 (= I148), C163 (= C150), R165 (= R152), C166 (= C153), F181 (≠ M168), C209 (= C197), P210 (= P198), V211 (= V199), A213 (= A201), L214 (= L202), C235 (≠ S223), L237 (≠ H225), C238 (≠ D226), V240 (≠ L228), G241 (= G229), C242 (≠ A230), C270 (≠ S258), G273 (≠ D261), I387 (= I364)
Query Sequence
>RR42_RS05540 FitnessBrowser__Cup4G11:RR42_RS05540
MVELEIDGKKVEVAEGSLVMEAARQLGTYIPHFCYHRKLSIAANCRMCLVEVEKAPKALP
ACATPVTPGMKVFTNSEKAVKAQKSVMEFLLINHPLDCPICDQGGECQLQDLAVGYGASE
SRYKEEKRVVFHKNVGPLISMEEMSRCIHCTRCVRFGQEVAGVMELGMLGRGEHSEITTF
VGQTVDSELSGNMIDLCPVGALTSKPFRYSARTWELARRKSVSPHDGLGANLVVQTKNQR
VMRVLPLDNEAVNECWLSDKDRFSYEGLNSPDRLTKPLVKQGGEWMETDWQTALEYVANG
LASIKRDHGADQIAALASPHSTLEELHLLGKLVRGLGSDNVDFRQRQTDFSAAIKGAPWL
GLPIADVSALQRVLVIGSALRKDHPLLAARLRQAGKKGARVAVLGASADDLLMPLAARID
VAPSGWTAALAGVARAVAAAKGVAAPAGTDGFDGDDKARLVADALLSGERRAVFLGNEAV
RHPQFAALHALAQWIATETGATLGFLTEAANTVGGYIAGALPQNGGANAQAMFDTPRRAY
VLLNTEPEFDAANPTQALAALAQAGTVVVLSAFRSDAALQYADVILPVTPFTETAGTFVN
CEGLPQSFNGVVRALGDSRPGWKVLRVLGNLLDVPGFDFETAESVRDEVLAKPVAPQLNN
GTDAAIRVTAQVAGGIERIADVPIYHADPIVRRADSLQLSAAARRAMQAGLSADLFASLG
VQAGDPVRVTQGQGSVVLPAALEAMLPAGTVRVSAGTVAATTLGAPSGTVTVEKAIDLAA
TAKGAAEPAATA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory