SitesBLAST
Comparing RR42_RS11300 FitnessBrowser__Cup4G11:RR42_RS11300 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rfvA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens complexed with nadh and product (see paper)
45% identity, 94% coverage: 1:255/272 of query aligns to 2:257/265 of 3rfvA
- binding D-galactaro-1,5-lactone: S74 (= S74), S110 (= S110), N111 (= N111), H112 (= H112), Y135 (= Y135), S164 (= S164), R173 (= R173), F257 (= F255)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G9 (= G8), G12 (= G11), Q13 (= Q12), L14 (= L13), D33 (≠ G32), L34 (≠ N33), D50 (= D50), L51 (= L51), L70 (≠ M70), G71 (≠ A71), G72 (= G72), S74 (= S74), A108 (= A108), S110 (= S110), Y135 (= Y135), K139 (= K139), I162 (= I162), S164 (= S164), C165 (= C165)
Q7CRQ0 Uronate dehydrogenase; D-galacturonate dehydrogenase; D-glucuronate dehydrogenase; Hexuronate dehydrogenase; EC 1.1.1.203 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
45% identity, 94% coverage: 1:255/272 of query aligns to 1:256/265 of Q7CRQ0
- Y134 (= Y135) mutation to A: 0.1% of wild-type activity.
3rfxA Crystal structure of uronate dehydrogenase from agrobacterium tumefaciens, y136a mutant complexed with NAD (see paper)
45% identity, 94% coverage: 1:255/272 of query aligns to 2:257/265 of 3rfxA
6k0iA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glc (see paper)
30% identity, 54% coverage: 2:147/272 of query aligns to 1:161/335 of 6k0iA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D31 (≠ G32), N32 (= N33), N35 (≠ S36), S36 (≠ L37), D58 (= D50), V59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (vs. gap), K84 (vs. gap), N99 (= N85), S122 (≠ A108), S123 (= S109), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-glucose: K84 (vs. gap), S124 (= S110), Y149 (= Y135)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-glucose: 178, 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
6k0hA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp-glcnac (see paper)
30% identity, 54% coverage: 2:147/272 of query aligns to 1:161/335 of 6k0hA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D31 (≠ G32), N32 (= N33), G34 (≠ Q35), N35 (≠ S36), S36 (≠ L37), D58 (= D50), V59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (vs. gap), K84 (vs. gap), N99 (= N85), S123 (= S109), Y149 (= Y135), K153 (= K139)
- binding uridine-diphosphate-n-acetylglucosamine: K84 (vs. gap), S124 (= S110), Y149 (= Y135)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-diphosphate-n-acetylglucosamine: 178, 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
6k0gA Crystal structure of udp-glucose 4-epimerase from bifidobacterium longum in complex with NAD+ and udp (see paper)
30% identity, 54% coverage: 2:147/272 of query aligns to 1:161/335 of 6k0gA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding magnesium ion: E66 (≠ D58), H114 (≠ Q100)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D31 (≠ G32), N32 (= N33), N35 (≠ S36), S36 (≠ L37), D58 (= D50), V59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (vs. gap), K84 (vs. gap), N99 (= N85), S122 (≠ A108), S123 (= S109), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate: 179, 198, 199, 200, 216, 217, 218, 231, 233, 268, 291, 294
1r6dA Crystal structure of desiv double mutant (dtdp-glucose 4,6- dehydratase) from streptomyces venezuelae with NAD and dau bound (see paper)
27% identity, 80% coverage: 3:220/272 of query aligns to 2:225/322 of 1r6dA
- active site: T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding 2'deoxy-thymidine-5'-diphospho-alpha-d-glucose: S87 (= S74), H88 (vs. gap), T127 (≠ S110), N128 (= N111), Q129 (≠ H112), Y151 (= Y135), N180 (≠ E167), K190 (≠ D183), L191 (= L184), P206 (≠ V201), Y208 (≠ W203), R215 (= R210)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D37 (vs. gap), S38 (≠ D27), L39 (= L28), T40 (≠ R29), A42 (≠ S31), G43 (= G32), D63 (= D50), I64 (≠ L51), F83 (≠ M70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
Sites not aligning to the query:
1r66A Crystal structure of desiv (dtdp-glucose 4,6-dehydratase) from streptomyces venezuelae with NAD and tyd bound (see paper)
26% identity, 80% coverage: 3:220/272 of query aligns to 2:225/322 of 1r66A
- active site: T127 (≠ S110), D128 (≠ N111), E129 (≠ H112), Y151 (= Y135), K155 (= K139)
- binding nicotinamide-adenine-dinucleotide: G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D37 (vs. gap), S38 (≠ D27), L39 (= L28), T40 (≠ R29), G43 (= G32), D63 (= D50), I64 (≠ L51), F83 (≠ M70), A84 (= A71), A85 (≠ G72), S87 (= S74), T102 (≠ N85), V125 (≠ A108), S126 (= S109), Y151 (= Y135), K155 (= K139), N181 (≠ R168)
- binding thymidine-5'-diphosphate: H88 (vs. gap), E129 (≠ H112), N180 (≠ E167), K190 (≠ D183), L191 (= L184), P206 (≠ V201), Y208 (≠ W203), R215 (= R210)
Sites not aligning to the query:
7eprB Partial consensus l-threonine 3-dehydrogenase (c-change) (see paper)
30% identity, 58% coverage: 3:161/272 of query aligns to 3:166/310 of 7eprB
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), Q12 (= Q12), I13 (≠ L13), D34 (= D27), I35 (≠ L28), R36 (= R29), D50 (vs. gap), A51 (vs. gap), L72 (= L67), A73 (≠ I68), A74 (≠ H69), L90 (≠ N85), P113 (≠ A108), Y140 (= Y135), K144 (= K139)
Sites not aligning to the query:
6wjaA Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac (see paper)
28% identity, 59% coverage: 3:162/272 of query aligns to 2:170/307 of 6wjaA
- active site: A118 (≠ S110), A119 (≠ N111), A120 (≠ H112), F143 (≠ Y135), K147 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), F11 (≠ Q12), I12 (≠ L13), D31 (vs. gap), D32 (vs. gap), S34 (= S30), T35 (≠ S31), G36 (= G32), A55 (≠ L51), L74 (≠ M70), A75 (= A71), A76 (≠ G72), S93 (≠ N85), F143 (≠ Y135), K147 (= K139), F170 (≠ I162)
- binding uridine-diphosphate-n-acetylgalactosamine: V80 (vs. gap), A120 (≠ H112)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 171, 173
- binding uridine-diphosphate-n-acetylgalactosamine: 172, 186, 187, 191, 202, 204, 211, 247, 270, 273
6wj9B Udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-glcnac (see paper)
28% identity, 59% coverage: 3:162/272 of query aligns to 3:171/308 of 6wj9B
- active site: A119 (≠ S110), A120 (≠ N111), A121 (≠ H112), F144 (≠ Y135), K148 (= K139)
- binding nicotinamide-adenine-dinucleotide: G8 (= G8), G11 (= G11), F12 (≠ Q12), I13 (≠ L13), D32 (vs. gap), D33 (vs. gap), S35 (= S30), T36 (≠ S31), G37 (= G32), D55 (= D50), A56 (≠ L51), L75 (≠ M70), A76 (= A71), A77 (≠ G72), S94 (≠ N85), A117 (= A108), A119 (≠ S110), F144 (≠ Y135), K148 (= K139), F171 (≠ I162)
- binding uridine-diphosphate-n-acetylglucosamine: V81 (vs. gap)
Sites not aligning to the query:
- binding nicotinamide-adenine-dinucleotide: 172, 174
- binding uridine-diphosphate-n-acetylglucosamine: 173, 187, 188, 192, 203, 204, 205, 212, 248, 271, 274
5z75A Artificial l-threonine 3-dehydrogenase designed by ancestral sequence reconstruction. (see paper)
28% identity, 59% coverage: 1:161/272 of query aligns to 2:166/306 of 5z75A
- binding nicotinamide-adenine-dinucleotide: G9 (= G8), C11 (≠ G10), G12 (= G11), Q13 (= Q12), I14 (≠ L13), D35 (≠ Q35), I36 (≠ S36), L49 (≠ G49), V51 (≠ L51), L72 (≠ M70), A73 (= A71), L76 (vs. gap), P113 (≠ A108), S115 (= S110), Y140 (= Y135), K144 (= K139)
Sites not aligning to the query:
7epsA Partial consensus l-threonine 3-dehydrogenase (e-change) (see paper)
30% identity, 58% coverage: 3:161/272 of query aligns to 2:165/310 of 7epsA
- binding nicotinamide-adenine-dinucleotide: N9 (≠ G10), G10 (= G11), Q11 (= Q12), I12 (≠ L13), D33 (= D27), V34 (≠ L28), L48 (≠ G43), A50 (≠ E45), L71 (≠ I68), A72 (≠ H69), A73 (≠ M70), L89 (vs. gap), P112 (≠ A108), Y139 (= Y135), K143 (= K139)
- binding threonine: S76 (≠ T73), S114 (= S110), Y139 (= Y135)
Sites not aligning to the query:
3a1nA Crystal structure of l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
23% identity, 62% coverage: 4:171/272 of query aligns to 2:173/315 of 3a1nA
- active site: T112 (≠ S110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ Q35), I33 (≠ S36), L46 (≠ G49), D47 (= D50), L69 (≠ M70), A70 (= A71), G71 (= G72), L73 (vs. gap), S111 (= S109), Y137 (= Y135), K141 (= K139), Y164 (≠ I162)
3a4vA Crystal structure of pyruvate bound l-threonine dehydrogenase from hyperthermophilic archaeon thermoplasma volcanium (see paper)
23% identity, 62% coverage: 4:171/272 of query aligns to 2:173/311 of 3a4vA
- active site: T112 (≠ S110), Y137 (= Y135), K141 (= K139)
- binding nicotinamide-adenine-dinucleotide: S8 (≠ G10), G9 (= G11), Q10 (= Q12), I11 (≠ L13), D32 (≠ Q35), I33 (≠ S36), L46 (≠ G49), D47 (= D50), V48 (≠ L51), L69 (≠ M70), A70 (= A71), G71 (= G72), L73 (vs. gap), P110 (≠ A108), S111 (= S109), T112 (≠ S110), Y137 (= Y135), K141 (= K139), Y164 (≠ I162), I167 (≠ C165)
- binding pyruvic acid: S74 (vs. gap), Y137 (= Y135)
Sites not aligning to the query:
2udpA Udp-galactose 4-epimerase complexed with udp-phenol (see paper)
28% identity, 53% coverage: 3:145/272 of query aligns to 2:159/338 of 2udpA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ S31), C34 (≠ G32), N35 (= N33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), S124 (= S110), Y149 (= Y135), K153 (= K139)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177
- binding phenyl-uridine-5'-diphosphate: 179, 199, 200, 216, 217, 218, 231, 233, 269, 292, 295
1udcA Structure of udp-galactose-4-epimerase complexed with udp-mannose (see paper)
28% identity, 53% coverage: 3:145/272 of query aligns to 2:159/338 of 1udcA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), C34 (≠ G32), N35 (= N33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-mannose: T126 (≠ H112), Y149 (= Y135)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-mannose: 179, 199, 200, 215, 216, 217, 218, 231, 233, 269, 292
P09147 UDP-glucose 4-epimerase; Galactowaldenase; UDP-galactose 4-epimerase; EC 5.1.3.2 from Escherichia coli (strain K12) (see 10 papers)
28% identity, 53% coverage: 3:145/272 of query aligns to 2:159/338 of P09147
- YI 11:12 (≠ QL 12:13) binding
- DNLCNS 31:36 (≠ RSSGNS 29:34) binding
- DI 58:59 (≠ DL 50:51) binding
- FAGLK 80:84 (≠ MAG-- 70:72) binding
- N99 (= N85) binding
- S124 (= S110) binding ; mutation to A: No major structural changes. Catalytic efficiency is very low and affinity binding is 21% of the wild-type enzyme.; mutation to T: No major structural changes. Catalytic efficiency is about 30% of that of the wild-type enzyme, and affinity binding is similar to that of the native enzyme.
- Y149 (= Y135) active site, Proton acceptor; binding ; mutation to F: No major structural changes. Catalytic efficiency is very low and affinity binding is 12% of the wild-type enzyme.
- K153 (= K139) binding ; mutation to A: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.; mutation to M: Decreases the catalytic activity. Not reduced by sugars in the presence or absence of UMP. It contains very little NADH.
Sites not aligning to the query:
- 178 binding
- 299 Y→C: Loss of epimerase activity with UDP-Gal by almost 5-fold, but it results in a gain of epimerase activity with uridine diphosphate N-acetylglucosamine (UDP-GlcNAc) by 230-fold with minimal changes in its three-dimensional structure.
1udaA Structure of udp-galactose-4-epimerase complexed with udp-4-deoxy-4- fluoro-alpha-d-galactose (see paper)
28% identity, 53% coverage: 3:145/272 of query aligns to 2:159/338 of 1udaA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ S31), C34 (≠ G32), N35 (= N33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (= G72), K84 (vs. gap), S122 (≠ A108), Y149 (= Y135), K153 (= K139)
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: T126 (≠ H112)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding uridine-5'-diphosphate-4-deoxy-4-fluoro-alpha-d-galactose: 179, 199, 200, 216, 217, 218, 231, 233, 292, 295, 299
1naiA Udp-galactose 4-epimerase from escherichia coli, oxidized (see paper)
28% identity, 53% coverage: 3:145/272 of query aligns to 2:159/338 of 1naiA
- active site: S124 (= S110), A125 (≠ N111), T126 (≠ H112), Y149 (= Y135), K153 (= K139)
- binding nicotinamide-adenine-dinucleotide: G7 (= G8), G10 (= G11), Y11 (≠ Q12), I12 (≠ L13), D31 (≠ R29), N32 (≠ S30), L33 (≠ S31), C34 (≠ G32), N35 (= N33), S36 (= S34), D58 (= D50), I59 (≠ L51), F80 (≠ M70), A81 (= A71), G82 (= G72), K84 (vs. gap), Y149 (= Y135), K153 (= K139)
- binding 1,3-propandiol: N35 (= N33), K84 (vs. gap)
Sites not aligning to the query:
- active site: 189
- binding nicotinamide-adenine-dinucleotide: 177, 180
- binding 1,3-propandiol: 191, 193
- binding uridine-5'-diphosphate: 179, 199, 200, 215, 216, 231, 233, 292
Query Sequence
>RR42_RS11300 FitnessBrowser__Cup4G11:RR42_RS11300
MTKIALSGAGGQLGTVLRTALLARGYDLRSSGNSQSLAPVAEGEEVMRGDLCDPAVVDRL
LDGVDVLIHMAGTSVERPLPEIIDNNLRALVEVYEGARRQKVGRIVFASSNHAIGMYPVD
QQLSTDCEFRPDGFYGLSKMWGEGLARLYWDKHGIESVCVRIGSCVERPQEFRHLSTWLG
HEDLVHLIEQGITVPDLGFLVVWGVSANARSCWNNDGAARLRYRPKQNAEDFAEEILAGP
NPLDAIGRQYQGGSFASIDFTPEAQRHGGAHR
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory