Comparing RR42_RS14625 FitnessBrowser__Cup4G11:RR42_RS14625 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
31% identity, 94% coverage: 20:311/312 of query aligns to 2:291/298 of 4mynA
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
24% identity, 92% coverage: 20:306/312 of query aligns to 21:308/321 of 3m1rD
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
26% identity, 80% coverage: 57:306/312 of query aligns to 39:278/293 of 3pzlB
6dktA Crystal structure of arginase from bacillus subtilis
26% identity, 82% coverage: 57:311/312 of query aligns to 16:278/283 of 6dktA
6dktE Crystal structure of arginase from bacillus subtilis
25% identity, 82% coverage: 57:311/312 of query aligns to 16:263/268 of 6dktE
7esrA Crystal structure of synechocystis sp pcc6803 guanidinium hydrolase (r32) (see paper)
25% identity, 82% coverage: 57:312/312 of query aligns to 91:352/378 of 7esrA
3nioA Crystal structure of pseudomonas aeruginosa guanidinobutyrase (see paper)
26% identity, 82% coverage: 57:311/312 of query aligns to 51:307/316 of 3nioA
Q9I3S3 Guanidinobutyrase; EC 3.5.3.7 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
26% identity, 82% coverage: 57:311/312 of query aligns to 54:310/319 of Q9I3S3
2ef5A Crystal structure of the arginase from thermus thermophilus
29% identity, 74% coverage: 81:311/312 of query aligns to 36:268/273 of 2ef5A
Sites not aligning to the query:
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 46:289/299 of 1cevA
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 46:289/299 of P53608
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 45:288/298 of 5cevA
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 45:288/298 of 4cevA
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 45:288/298 of 3cevA
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
26% identity, 76% coverage: 71:306/312 of query aligns to 45:288/298 of 2cevB
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
26% identity, 82% coverage: 57:311/312 of query aligns to 43:295/303 of 1wogA
8snfD Crystal structure of metformin hydrolase (mfmab) from pseudomonas mendocina sp. Met-2 with ni2+2 bound (see paper)
26% identity, 73% coverage: 84:311/312 of query aligns to 110:334/347 of 8snfD
8snkA Crystal structure of metformin hydrolase (mfmab) from pseudomonas mendocina sp. Met-2 mutant (mfma/d188n) (see paper)
25% identity, 73% coverage: 84:311/312 of query aligns to 110:334/345 of 8snkA
P46637 Arginase 1, mitochondrial; Agmatinase ARGAH1; Arginine amidohydrolase 1; AtARGAH1; EC 3.5.3.1; EC 3.5.3.11 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
29% identity, 63% coverage: 116:312/312 of query aligns to 154:338/342 of P46637
Sites not aligning to the query:
6vsuE Arginase from arabidopsis thaliana in complex with ornithine (see paper)
29% identity, 63% coverage: 116:312/312 of query aligns to 130:314/318 of 6vsuE
>RR42_RS14625 FitnessBrowser__Cup4G11:RR42_RS14625
MAAAPGSIWRGRSDAGELGDTRRLFHVVRAQGAERVPGAPVLLGFCCDAGVLRNLGRPGA
AGGPREIRRALAGIPAHGLAAFHDAGDVVCHDGDLETAQQALATAVAAELAQGAFPLVLG
GGHEIAWGTWQGLRAHLDARGDHGRVLVINLDAHFDLRTGRPGSSGTPFDQIAQACHERG
QRFEYACLGVSRLGNTAALFAHAQALGVHYVEDVQMQERHLDARLAELQGLMDAVDHVYL
TIDLDVLPAAVMPAVSAPAPYGVPLPVVEEVVALVRASGKLRVADLAEFNPLYDRDACGA
RAAARLAYRLMA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory