Comparing RR42_RS15740 FitnessBrowser__Cup4G11:RR42_RS15740 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5u2kA Crystal structure of galactoside o-acetyltransferase complex with coa (h3 space group)
35% identity, 74% coverage: 41:158/159 of query aligns to 74:181/190 of 5u2kA
4isxA The crystal structure of maltose o-acetyltransferase from clostridium difficile 630 in complex with acetyl-coa
33% identity, 72% coverage: 44:158/159 of query aligns to 77:181/186 of 4isxA
Sites not aligning to the query:
4mzuF Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
33% identity, 79% coverage: 34:159/159 of query aligns to 39:142/294 of 4mzuF
Sites not aligning to the query:
4n27A X-ray structure of brucella abortus rica (see paper)
53% identity, 31% coverage: 110:158/159 of query aligns to 93:143/175 of 4n27A
Sites not aligning to the query:
3igjC Crystal structure of maltose o-acetyltransferase complexed with acetyl coenzyme a from bacillus anthracis
33% identity, 77% coverage: 36:158/159 of query aligns to 91:183/188 of 3igjC
Sites not aligning to the query:
4mzuB Crystal structure of fdtd, a bifunctional ketoisomerase/n- acetyltransferase from shewanella denitrificans (see paper)
31% identity, 79% coverage: 34:159/159 of query aligns to 39:141/290 of 4mzuB
Sites not aligning to the query:
1krrA Galactoside acetyltransferase in complex with acetyl-coenzyme a (see paper)
25% identity, 82% coverage: 28:158/159 of query aligns to 41:181/200 of 1krrA
Sites not aligning to the query:
1krvA Galactoside acetyltransferase in complex with coa and pnp-beta-gal (see paper)
25% identity, 82% coverage: 28:158/159 of query aligns to 41:181/201 of 1krvA
Sites not aligning to the query:
1kruA Galactoside acetyltransferase in complex with iptg and coenzyme a (see paper)
25% identity, 82% coverage: 28:158/159 of query aligns to 41:181/201 of 1kruA
Sites not aligning to the query:
P07464 Galactoside O-acetyltransferase; GAT; Acetyl-CoA:galactoside 6-O-acetyltransferase; Thiogalactoside acetyltransferase; Thiogalactoside transacetylase; EC 2.3.1.18 from Escherichia coli (strain K12) (see 3 papers)
25% identity, 82% coverage: 28:158/159 of query aligns to 42:182/203 of P07464
Sites not aligning to the query:
3fscA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-fucose (see paper)
26% identity, 73% coverage: 41:156/159 of query aligns to 86:217/259 of 3fscA
Sites not aligning to the query:
3fs8A Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d- glucose n-acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with acetyl-coa (see paper)
26% identity, 73% coverage: 41:156/159 of query aligns to 86:217/259 of 3fs8A
Sites not aligning to the query:
3fsbA Crystal structure of qdtc, the dtdp-3-amino-3,6-dideoxy-d-glucose n- acetyl transferase from thermoanaerobacterium thermosaccharolyticum in complex with coa and dtdp-3-amino-quinovose (see paper)
26% identity, 73% coverage: 41:156/159 of query aligns to 86:217/260 of 3fsbA
Sites not aligning to the query:
4n6bA Soybean serine acetyltransferase complexed with coa (see paper)
37% identity, 69% coverage: 50:158/159 of query aligns to 142:233/233 of 4n6bA
4n69A Soybean serine acetyltransferase complexed with serine (see paper)
34% identity, 69% coverage: 50:158/159 of query aligns to 149:243/243 of 4n69A
2fkoA Structure of ph1591 from pyrococcus horikoshii ot3 (see paper)
45% identity, 31% coverage: 110:158/159 of query aligns to 91:141/173 of 2fkoA
Sites not aligning to the query:
1v3wA Structure of ferripyochelin binding protein from pyrococcus horikoshii ot3 (see paper)
45% identity, 31% coverage: 110:158/159 of query aligns to 91:141/173 of 1v3wA
Sites not aligning to the query:
7l7yAAA Putative acetyl transferase protein (see paper)
44% identity, 31% coverage: 110:159/159 of query aligns to 163:217/217 of 7l7yAAA
Sites not aligning to the query:
7l82AAA Putative acetyl transferase protein (see paper)
44% identity, 31% coverage: 110:158/159 of query aligns to 163:216/216 of 7l82AAA
Sites not aligning to the query:
7l81AAA Putative acetyl transferase protein (see paper)
44% identity, 31% coverage: 110:158/159 of query aligns to 163:216/216 of 7l81AAA
Sites not aligning to the query:
>RR42_RS15740 FitnessBrowser__Cup4G11:RR42_RS15740
MNLLGMLLRPFMVYGYFSRREGRFLRFTRVSSSAKILSERDLVIGDHCWIGPHCLIDASG
GVEIGEGVQISSLNAVLSHSSHVSIRLLGRHFISTPTPQRTGFIQAPVAIGDFTFVGSGA
IILPGTRIGKGCVIGAGSVVRGEIPDHSVVVGNPGRIVG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory