SitesBLAST
Comparing RR42_RS17310 FitnessBrowser__Cup4G11:RR42_RS17310 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
30% identity, 44% coverage: 19:184/374 of query aligns to 61:220/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (≠ L31), G75 (= G33), S76 (≠ G34), G77 (= G35), T78 (≠ S36), G79 (≠ K37), L80 (≠ D38), A83 (≠ G41), C84 (≠ Q42), P137 (≠ D101), G138 (= G102), E139 (≠ S103), A142 (= A106), T143 (= T107), G146 (= G110), N147 (≠ A111), S149 (≠ A113), T150 (≠ A114), A152 (≠ L116), G153 (≠ S117), E203 (≠ L167), G204 (= G168), I209 (= I173)
Sites not aligning to the query:
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 44% coverage: 20:184/374 of query aligns to 58:217/465 of 3pm9A
- active site: A149 (≠ L116), L159 (≠ A126)
- binding flavin-adenine dinucleotide: P69 (≠ L31), Q70 (≠ R32), G71 (= G33), G72 (= G34), N73 (≠ G35), T74 (≠ S36), G75 (≠ K37), L76 (≠ D38), G79 (= G41), Q80 (= Q42), L91 (≠ T51), L133 (≠ T98), G134 (= G99), A135 (= A100), C139 (≠ A106), T140 (= T107), G142 (= G109), G143 (= G110), S146 (≠ A113), T147 (≠ A114), A149 (≠ L116), G150 (≠ S117), E200 (≠ L167), G201 (= G168), I205 (≠ L172), I206 (= I173)
Sites not aligning to the query:
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
29% identity, 36% coverage: 49:184/374 of query aligns to 258:385/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
29% identity, 36% coverage: 49:184/374 of query aligns to 258:385/658 of P97275
- H300 (≠ F91) mutation to A: Loss of activity.
- 303:309 (vs. 101:107, 29% identical) binding
- T309 (= T107) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ AGLS 114:117) binding
- S367 (= S166) mutation to A: Strongly reduced activity.
- 368:374 (vs. 167:173, 71% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 234:240 binding
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 178:305/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (= D101)
- binding flavin-adenine dinucleotide: P222 (= P93), D223 (= D101), S224 (≠ G102), S228 (≠ A106), T229 (= T107), G232 (= G110), W233 (≠ A111), S235 (≠ A113), T236 (≠ A114), A238 (≠ L116), S239 (= S117), E288 (≠ L167), V293 (≠ L172), I294 (= I173)
Sites not aligning to the query:
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: 411, 421, 422, 423, 474, 476, 478
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 161, 164, 512
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 164:291/539 of 5ae3A
- binding flavin-adenine dinucleotide: P208 (= P93), D209 (= D101), S210 (≠ G102), S214 (≠ A106), T215 (= T107), G218 (= G110), W219 (≠ A111), S221 (≠ A113), T222 (≠ A114), A224 (≠ L116), S225 (= S117), E274 (≠ L167), V279 (≠ L172), I280 (= I173)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 140, 141, 142, 143, 144, 145, 146, 147, 151, 497
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 178:305/557 of 5adzC
- binding flavin-adenine dinucleotide: P222 (= P93), D223 (= D101), S224 (≠ G102), S228 (≠ A106), T229 (= T107), G232 (= G110), W233 (≠ A111), S235 (≠ A113), T236 (≠ A114), A238 (≠ L116), S239 (= S117), E288 (≠ L167), G289 (= G168), I294 (= I173)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (= D101)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 154, 155, 156, 157, 158, 159, 160, 515
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 410, 414, 424, 425, 426, 477, 515, 516
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
28% identity, 48% coverage: 2:182/374 of query aligns to 46:213/459 of P9WIT1
Sites not aligning to the query:
- 354 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 169:296/561 of 5ae2A
- binding flavin-adenine dinucleotide: P213 (= P93), D214 (= D101), S215 (≠ G102), S219 (≠ A106), T220 (= T107), G223 (= G110), W224 (≠ A111), S226 (≠ A113), T227 (≠ A114), A229 (≠ L116), S230 (= S117), E279 (≠ L167), V284 (≠ L172), I285 (= I173)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 145, 146, 147, 148, 149, 150, 151, 155, 156, 519
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 415, 418, 428, 429, 430, 481, 483, 519
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 164:291/542 of 5ae2B
- binding flavin-adenine dinucleotide: P208 (= P93), D209 (= D101), S210 (≠ G102), S214 (≠ A106), T215 (= T107), G218 (= G110), W219 (≠ A111), S221 (≠ A113), T222 (≠ A114), A224 (≠ L116), S225 (= S117), E274 (≠ L167), G275 (= G168), V279 (≠ L172), I280 (= I173)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 150, 151, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 164:291/543 of 4bc7B
- binding flavin-adenine dinucleotide: P208 (= P93), D209 (= D101), S210 (≠ G102), S214 (≠ A106), T215 (= T107), G218 (= G110), S221 (≠ A113), T222 (≠ A114), A224 (≠ L116), S225 (= S117), E274 (≠ L167), G275 (= G168), I280 (= I173)
Sites not aligning to the query:
- binding 1-dodecanol: 410, 412
- binding flavin-adenine dinucleotide: 16, 140, 142, 143, 144, 145, 146, 147, 150, 151, 501
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 164:291/542 of 4bc9B
- binding propanenitrile: D209 (= D101)
- binding flavin-adenine dinucleotide: P208 (= P93), D209 (= D101), S210 (≠ G102), S214 (≠ A106), T215 (= T107), G218 (= G110), W219 (≠ A111), S221 (≠ A113), T222 (≠ A114), A224 (≠ L116), S225 (= S117), E274 (≠ L167), G275 (= G168), I280 (= I173)
Sites not aligning to the query:
- binding propanenitrile: 462, 501
- binding flavin-adenine dinucleotide: 140, 142, 143, 144, 145, 146, 147, 150, 151, 500
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 169:296/555 of 4bc9A
- binding propanenitrile: D214 (= D101)
- binding flavin-adenine dinucleotide: P213 (= P93), D214 (= D101), S215 (≠ G102), S219 (≠ A106), T220 (= T107), G223 (= G110), W224 (≠ A111), S226 (≠ A113), T227 (≠ A114), A229 (≠ L116), S230 (= S117), E279 (≠ L167), V284 (≠ L172), I285 (= I173)
Sites not aligning to the query:
- binding propanenitrile: 475, 513, 514
- binding flavin-adenine dinucleotide: 145, 146, 147, 148, 149, 150, 151, 152, 155, 156, 513
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
29% identity, 44% coverage: 19:184/374 of query aligns to 116:276/521 of Q8N465
- N127 (≠ R30) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G34) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ L48) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ Y54) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T73) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (≠ A90) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A113) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G139) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G141) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 109 S → W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 375 D → Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- 386 binding ; binding ; binding ; R→A: Loss of catalytic activity.
- 390 binding ; binding ; T→A: Significantly reduced catalytic activity.
- 399 V → M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
- 401 binding ; binding ; K→A: Loss of catalytic activity.
- 419 R → H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- 426 A → T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- 434 binding ; H→A: Loss of catalytic activity.
- 436 G → V: slight reduction in catalytic activity
- 439 N → D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- 441 binding ; H→A: Loss of catalytic activity.
- 443 binding ; N→A: Significantly reduced catalytic activity.
- 444 V → A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- 446 A → V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- 475 binding ; E→A: Loss of catalytic activity.
- 476 binding ; binding ; binding ; H→A: Loss of catalytic activity.
- 477 G → R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 164:291/539 of 5ae1B
- binding flavin-adenine dinucleotide: P208 (= P93), D209 (= D101), S210 (≠ G102), S214 (≠ A106), T215 (= T107), G218 (= G110), W219 (≠ A111), S221 (≠ A113), T222 (≠ A114), A224 (≠ L116), S225 (= S117), E274 (≠ L167), V279 (≠ L172), I280 (= I173)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 392, 396, 406, 407, 408, 459, 497
- binding flavin-adenine dinucleotide: 16, 140, 141, 142, 143, 144, 145, 146, 150, 151, 497, 535
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 166:293/566 of 5adzA
- binding flavin-adenine dinucleotide: P210 (= P93), D211 (= D101), S212 (≠ G102), S216 (≠ A106), T217 (= T107), G220 (= G110), W221 (≠ A111), S223 (≠ A113), T224 (≠ A114), A226 (≠ L116), S227 (= S117), E276 (≠ L167), G277 (= G168), V281 (≠ L172), I282 (= I173)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (= D101)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 142, 143, 144, 145, 146, 147, 148, 152, 524
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): 423, 433, 434, 435, 486, 488, 489, 524, 525
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
29% identity, 36% coverage: 49:184/374 of query aligns to 163:290/560 of 5ae1A
- binding flavin-adenine dinucleotide: P207 (= P93), D208 (= D101), S209 (≠ G102), S213 (≠ A106), T214 (= T107), G216 (= G109), G217 (= G110), W218 (≠ A111), S220 (≠ A113), T221 (≠ A114), A223 (≠ L116), S224 (= S117), E273 (≠ L167), G274 (= G168), V278 (≠ L172), I279 (= I173)
Sites not aligning to the query:
- binding (3-(2-fluorophenyl)-n-(1-(2-oxo-2,3-dihydro-1h-benzo[d]imidazol-5-yl)ethyl)butanamide): 416, 417, 427, 428, 429, 480, 518
- binding flavin-adenine dinucleotide: 139, 140, 141, 142, 143, 144, 145, 146, 149, 150, 518
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
29% identity, 44% coverage: 19:184/374 of query aligns to 64:224/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ L31), G78 (= G33), G79 (= G34), N80 (≠ G35), T81 (≠ S36), G82 (≠ K37), M83 (≠ D38), G86 (= G41), S87 (≠ Q42), L140 (≠ T98), A142 (= A100), C146 (≠ A106), H147 (≠ T107), G150 (= G110), N151 (≠ A111), A153 (= A113), T154 (≠ A114), G208 (= G168), I212 (≠ L172), I213 (= I173)
Sites not aligning to the query:
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
29% identity, 44% coverage: 19:184/374 of query aligns to 63:223/466 of 6lpxA
- binding flavin-adenine dinucleotide: P75 (≠ L31), Q76 (≠ R32), G77 (= G33), G78 (= G34), N79 (≠ G35), T80 (≠ S36), G81 (≠ K37), M82 (≠ D38), G85 (= G41), S86 (≠ Q42), L139 (≠ T98), G140 (= G99), A141 (= A100), C145 (≠ A106), G149 (= G110), N150 (≠ A111), A152 (= A113), T153 (≠ A114), G157 (= G118), G207 (= G168), I212 (= I173)
Sites not aligning to the query:
- binding 2-oxoglutaric acid: 333, 337, 348, 379, 381, 388, 423
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding zinc ion: 381, 388, 422
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
29% identity, 44% coverage: 19:184/374 of query aligns to 63:223/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ L31), G77 (= G33), G78 (= G34), N79 (≠ G35), T80 (≠ S36), G81 (≠ K37), G85 (= G41), S86 (≠ Q42), L139 (≠ T98), G140 (= G99), A141 (= A100), C145 (≠ A106), H146 (≠ T107), G148 (= G109), G149 (= G110), N150 (≠ A111), A152 (= A113), T153 (≠ A114), A155 (≠ L116), E206 (≠ L167), G207 (= G168), I211 (≠ L172), I212 (= I173)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 39, 422, 459
- binding (2s)-2-hydroxypentanedioic acid: 333, 337, 348, 379, 381, 388, 423
- binding zinc ion: 381, 388, 422
Query Sequence
>RR42_RS17310 FitnessBrowser__Cup4G11:RR42_RS17310
MPATPADQQATLTAFRDAIRHATGTRTPLRLRGGGSKDFYGQHPQGTLLDTRAYSGIVDY
DPPELVITARCGTPLAQIEAALAERRQMLAFEPPHFSTGADGSDVATIGGAVAAGLSGPR
RQAVGALRDFVLGTRVMDGRGDVLSFGGQVMKNVAGYDVSRLMSGSLGTLGLILEVSLKV
LPVPFDDATLRFALDEAAALDRLNDWGGQPLPIAASAWHDGVLHLRLSGAAAALRAARAR
LGGEAVDAAQADALWRALREHSHAFFAPVQAGRALWRIAVPTTAAPLALPGGQLIEWGGG
QRWWLGGSDSAADSAIVRAAAKAAGGHATLFRNGDKAVGVFTPLSAPVAAIHQRLKATFD
PAGIFNPQRMYAGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory