SitesBLAST
Comparing RR42_RS17530 FitnessBrowser__Cup4G11:RR42_RS17530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 11 hits to proteins with known functional sites (download)
7wxiA Gpr domain of drosophila p5cs filament with glutamate and atpgammas (see paper)
38% identity, 96% coverage: 13:421/426 of query aligns to 5:407/430 of 7wxiA
7wxgA Gpr domain closed form of drosophila p5cs filament with glutamate, atp, and NADPH (see paper)
38% identity, 96% coverage: 13:421/426 of query aligns to 5:407/430 of 7wxgA
4jbeB 1.95 angstrom crystal structure of gamma-glutamyl phosphate reductase from saccharomonospora viridis.
31% identity, 96% coverage: 13:419/426 of query aligns to 8:408/412 of 4jbeB
5j7iB Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 99% coverage: 1:420/426 of query aligns to 4:448/456 of 5j7iB
5j7iC Crystal structure of a geobacillus thermoglucosidasius acetylating aldehyde dehydrogenase in complex with adp (see paper)
22% identity, 99% coverage: 1:420/426 of query aligns to 3:447/455 of 5j7iC
4yweA Crystal structure of a putative aldehyde dehydrogenase from burkholderia cenocepacia
25% identity, 93% coverage: 27:422/426 of query aligns to 58:476/476 of 4yweA
Sites not aligning to the query:
Q70DU8 Aldehyde dehydrogenase family 3 member H1; AtALDH4; Ath-ALDH4; EC 1.2.1.3 from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
24% identity, 72% coverage: 119:425/426 of query aligns to 112:463/484 of Q70DU8
- E149 (≠ S154) mutation to D: Small effect on NAD(+) interaction, but 40% loss of efficiency. Ability to use NADP(+). 70% loss of efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to N: Ability to use NADP(+) and 33% decreased efficiency with NAD(+). 70% loss of efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to Q: Loss of specificity for NAD(+) and loss of 25% efficiency. 15% efficiency with NAD(+); when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200.; mutation to T: Loss of specificity and increased NADP(+) binding. Decreased catalytic efficiency. Loss of cofactor specificity and same lower efficiency with both; when associated with V-200. Impaired affinity for both cofactors and decreased catalytic efficiency; when associated with G-200. Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with R-178 and V-200.
- V178 (≠ T186) mutation to R: Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with T-149 and V-200.
- I200 (= I214) mutation to G: Changed coenzyme preference from NAD(+) to NADP(+), but impaired affinities for both cofactors. No effect on the interaction with the substrate. Impaired affinities for both cofactors and decreased catalytic efficiencies; when associated with D-149, Q-149, N-149 or T-149.; mutation to V: Also able to use NADP(+) as coenzyme, but no effect on the interaction with the substrate. 15% efficiency with NAD(+); when associated with Q-149. 70% loss of efficiency with NAD(+); when associated with D-149 or N-149. Loss of cofactor specificity and same lower efficiency with both; when associated with T-149. Changed coenzyme preference from NAD(+) to NADP(+), but no effect on the catalytic efficiency; when associated with T-149 and R-178.
- C247 (≠ A250) mutation to S: No effect on solubility, but 10% loss of activity.
- C253 (vs. gap) mutation to S: No effect on solubility, but loss of activity.
Sites not aligning to the query:
- 45 C→S: Decreased solubility, loss of dimerization and strongly decreased activity.
4cazA Crystal structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa in complex with nadh
34% identity, 40% coverage: 81:250/426 of query aligns to 105:273/489 of 4cazA
- active site: N152 (≠ S129), K175 (≠ R151), E251 (vs. gap)
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: I148 (= I125), G149 (≠ I126), W151 (≠ E128), N152 (≠ S129), K175 (≠ R151), E178 (= E155), G208 (≠ D188), G212 (= G193), F226 (≠ P207), T227 (≠ R208), G228 (= G209), G229 (= G210), T232 (≠ L213), V236 (≠ L217), E251 (vs. gap), L252 (= L229)
Sites not aligning to the query:
- active site: 285, 386, 463
- binding [[(2R,3S,4R,5R)-5-[(3R)-3-aminocarbonyl-3,4-dihydro-2H-pyridin-1-yl]-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanidyl-phosphoryl] [(2R,3S,4R,5R)-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methyl phosphate: 285, 386, 388
2woxA Betaine aldehyde dehydrogenase from pseudomonas aeruginosa with NAD(p) h-catalytic thiol adduct. (see paper)
34% identity, 40% coverage: 81:250/426 of query aligns to 105:273/489 of 2woxA
- active site: N152 (≠ S129), K175 (≠ R151), E251 (vs. gap)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: I148 (= I125), G149 (≠ I126), W151 (≠ E128), N152 (≠ S129), K175 (≠ R151), S177 (= S154), E178 (= E155), G208 (≠ D188), G212 (= G193), F226 (≠ P207), T227 (≠ R208), G228 (= G209), G229 (= G210), T232 (≠ L213), V236 (≠ L217), E251 (vs. gap), L252 (= L229)
Sites not aligning to the query:
2wmeA Crystallographic structure of betaine aldehyde dehydrogenase from pseudomonas aeruginosa (see paper)
34% identity, 40% coverage: 81:250/426 of query aligns to 105:273/489 of 2wmeA
- active site: N152 (≠ S129), K175 (≠ R151), E251 (vs. gap)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G149 (≠ I126), W151 (≠ E128), K175 (≠ R151), S177 (= S154), E178 (= E155), G208 (≠ D188), G212 (= G193), F226 (≠ P207), G228 (= G209), G229 (= G210), T232 (≠ L213), V236 (≠ L217)
Sites not aligning to the query:
Q9HTJ1 NAD/NADP-dependent betaine aldehyde dehydrogenase; BADH; EC 1.2.1.8 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
34% identity, 38% coverage: 88:250/426 of query aligns to 113:274/490 of Q9HTJ1
- GAWN 150:153 (≠ IYES 126:129) binding
- K162 (≠ A137) active site, Charge relay system
- KP-SE 176:179 (≠ RGGSE 151:155) binding
- G209 (≠ D188) binding
- GTST 230:233 (≠ GKSL 210:213) binding
- E252 (vs. gap) active site, Proton acceptor
Sites not aligning to the query:
- 286 binding covalent; modified: Cysteine sulfenic acid (-SOH)
- 387 binding
- 464 active site, Charge relay system
Query Sequence
>RR42_RS17530 FitnessBrowser__Cup4G11:RR42_RS17530
MNELDLKQYMDRVGQQARAASRAMARASTADKNRALLTIAAAIRRDAAHLKAVNAGDVER
ARANGQDAAFIDRLTLSDKAIDTMAAGLEQIAALADPIGEISNMKFRPTGIQVGQMRVPL
GVIGIIYESRPNVTIDAAALCLKSGNATILRGGSEAIDSNTALAALVAEGLAAAGLPPEA
VQVISTTDRAAVGRLVTMTEYVDVIVPRGGKSLIARLMAEARVPMIKHLDGICHVYIDVD
ADLDKAVRVADNAKTQRYAPCNTMETLLVARAVAAAALPPLCRIYQEKGVELRVCAATRA
TLEAAGFTGLVDATEEDWRLEYLAPVLAIRTVAGLDEAIEHINTYGSAHTDSIITENYTT
GMRFLREVDSASVMINASTRFADGFEYGLGAEIGISNDKLHARGPVGLEGLTSLKYVVFG
HGEIRT
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory