SitesBLAST
Comparing RR42_RS17795 FitnessBrowser__Cup4G11:RR42_RS17795 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
5c7hA Crystal structure of aldo-keto reductase from sinorhizobium meliloti 1021 in complex with NADPH
60% identity, 97% coverage: 1:268/277 of query aligns to 5:272/281 of 5c7hA
- active site: D52 (= D48), Y57 (= Y53), K82 (= K78), H115 (= H111)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), T23 (= T19), W24 (= W20), D52 (= D48), Y57 (= Y53), H115 (= H111), Q167 (= Q163), Y195 (= Y191), S196 (= S192), P197 (= P193), L198 (≠ I194), E200 (≠ Q196), L204 (= L200), A221 (≠ V217), I237 (= I233), P238 (= P234), K239 (= K235), T240 (= T236), R245 (= R241), E248 (= E244), N249 (= N245)
Sites not aligning to the query:
4pmjA Crystal structure of a putative oxidoreductase from sinorhizobium meliloti 1021 in complex with NADP
60% identity, 97% coverage: 1:268/277 of query aligns to 5:272/281 of 4pmjA
- active site: D52 (= D48), Y57 (= Y53), K82 (= K78), H115 (= H111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), T23 (= T19), W24 (= W20), D52 (= D48), H115 (= H111), Q167 (= Q163), Y195 (= Y191), S196 (= S192), P197 (= P193), L198 (≠ I194), E200 (≠ Q196), L204 (= L200), A221 (≠ V217), I237 (= I233), P238 (= P234), K239 (= K235), T240 (= T236), G241 (≠ S237), R245 (= R241), E248 (= E244), N249 (= N245)
4wghA Crystal structure of aldo/keto reductase from klebsiella pneumoniae in complex with NADP and acetate at 1.8 a resolution
51% identity, 100% coverage: 2:277/277 of query aligns to 3:283/283 of 4wghA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (= T19), W21 (= W20), D49 (= D48), Y54 (= Y53), N142 (= N141), Q164 (= Q163), Y192 (= Y191), C193 (≠ S192), P194 (= P193), L195 (≠ I194), Q197 (= Q196), A198 (= A197), R200 (≠ L199), A223 (≠ V217), I239 (= I233), P240 (= P234), K241 (= K235), A242 (≠ T236), A243 (≠ S237), S244 (≠ H238), H247 (≠ R241), N251 (= N245)
6ciaA Crystal structure of aldo-keto reductase from klebsiella pneumoniae in complex with NADPH.
51% identity, 100% coverage: 2:277/277 of query aligns to 4:284/284 of 6ciaA
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T21 (= T19), W22 (= W20), D50 (= D48), Y55 (= Y53), H113 (= H111), N143 (= N141), Q165 (= Q163), Y193 (= Y191), C194 (≠ S192), P195 (= P193), L196 (≠ I194), Q198 (= Q196), A199 (= A197), A224 (≠ V217), I240 (= I233), P241 (= P234), K242 (= K235), A243 (≠ T236), A244 (≠ S237), S245 (≠ H238), H248 (≠ R241), N252 (= N245)
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
41% identity, 92% coverage: 9:263/277 of query aligns to 11:273/275 of 6kiyA
- binding {5-[(2E)-2-methyl-3-phenylprop-2-en-1-ylidene]-4-oxo-2-thioxo-1,3-thiazolidin-3-yl}acetic acid: W22 (= W20), Y59 (= Y53), W87 (≠ Y80), H118 (= H111), R204 (≠ Q196)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G20 (= G18), T21 (= T19), W22 (= W20), Y59 (= Y53), H118 (= H111), N149 (= N141), Q170 (= Q163), Y199 (= Y191), S200 (= S192), P201 (= P193), L202 (≠ I194), R204 (≠ Q196), T205 (≠ A197), Y227 (≠ V217), I243 (= I233), P244 (= P234), K245 (= K235), G247 (≠ S237), R248 (≠ H238), H251 (≠ R241), E254 (= E244), N255 (= N245)
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
41% identity, 92% coverage: 9:263/277 of query aligns to 11:273/275 of 6kikA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
41% identity, 92% coverage: 9:263/277 of query aligns to 10:272/274 of 5danA
- active site: D53 (= D48), Y58 (= Y53), K84 (= K78), H117 (= H111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), T20 (= T19), W21 (= W20), D53 (= D48), Y58 (= Y53), H117 (= H111), Q169 (= Q163), Y198 (= Y191), S199 (= S192), P200 (= P193), L201 (≠ I194), R203 (≠ Q196), Y226 (≠ V217), I242 (= I233), P243 (= P234), K244 (= K235), G246 (≠ S237), R247 (≠ H238), H250 (≠ R241), E253 (= E244), N254 (= N245)
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
32% identity, 92% coverage: 9:264/277 of query aligns to 10:308/337 of Q3L181
- D52 (= D48) mutation to A: 99% loss of activity.
- Y57 (= Y53) mutation to A: 99% loss of activity.
- K84 (= K78) mutation to A: Total loss of activity.
- H126 (= H111) mutation to A: 98% loss of activity.
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
33% identity, 92% coverage: 9:264/277 of query aligns to 10:276/287 of 3v0sA
- active site: D45 (= D48), Y50 (= Y53), G87 (= G88), H119 (= H111)
- binding 2'-monophosphoadenosine-5'-diphosphate: S198 (= S192), P199 (= P193), I200 (= I194), G201 (≠ E195), L204 (vs. gap), P246 (= P234), G247 (≠ K235), T248 (= T236), T249 (≠ S237), N253 (≠ R241), N256 (≠ E244), N257 (= N245)
A0QV10 Aldo-keto reductase MSMEG_2408/MSMEI_2347; EC 1.1.1.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
33% identity, 93% coverage: 4:261/277 of query aligns to 5:255/275 of A0QV10
Sites not aligning to the query:
- 262 modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
4gieA Crystal structure of prostaglandin f synthase from trypanosoma cruzi bound to NADP (see paper)
30% identity, 94% coverage: 3:262/277 of query aligns to 14:268/288 of 4gieA
- active site: D55 (= D48), Y60 (= Y53), K85 (= K78), H118 (= H111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G29 (= G18), W31 (= W20), D55 (= D48), Y60 (= Y53), H118 (= H111), W119 (= W112), N148 (= N141), Q169 (≠ N162), W195 (≠ Y191), S196 (= S192), P197 (= P193), L198 (≠ I194), S200 (vs. gap), L207 (= L200), A224 (≠ V217), I239 (= I233), P240 (= P234), K241 (= K235), S242 (≠ T236), R247 (= R241), E250 (= E244), N251 (= N245)
4fziA Crystal structure of prostaglandin f synthase from trypanosoma cruzi (see paper)
30% identity, 94% coverage: 3:262/277 of query aligns to 3:257/277 of 4fziA
4g5dA X-ray crystal structure of prostaglandin f synthase from leishmania major friedlin bound to NADPH (see paper)
32% identity, 94% coverage: 4:263/277 of query aligns to 8:267/283 of 4g5dA
- active site: D48 (= D48), Y53 (= Y53), K78 (= K78), H111 (= H111)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), V23 (≠ T19), W24 (= W20), D48 (= D48), Y53 (= Y53), H111 (= H111), S148 (= S140), N149 (= N141), Q170 (= Q163), W196 (≠ Y191), S197 (= S192), P198 (= P193), L199 (≠ I194), Q201 (= Q196), G202 (≠ A197), L205 (= L200), I237 (= I233), P238 (= P234), K239 (= K235), S240 (≠ T236), V241 (≠ S237), H242 (= H238), R245 (= R241), E248 (= E244), N249 (= N245)
1vbjA The crystal structure of prostaglandin f synthase from trypanosoma brucei
30% identity, 94% coverage: 2:262/277 of query aligns to 10:262/281 of 1vbjA
- active site: D52 (= D48), Y57 (= Y53), K82 (= K78), H115 (= H111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G26 (= G18), M27 (≠ T19), W28 (= W20), D52 (= D48), Y57 (= Y53), H115 (= H111), N145 (= N141), Q166 (≠ E158), W192 (≠ Y191), S193 (= S192), P194 (= P193), L195 (≠ I194), Q197 (= Q196), G198 (≠ A197), V201 (≠ L200), A218 (≠ V217), I233 (= I233), K235 (= K235), S236 (≠ T236), G237 (≠ S237), R241 (= R241), E244 (= E244), N245 (= N245)
Q9GV41 9,11-endoperoxide prostaglandin H2 reductase; Prostaglandin F2-alpha synthase; EC 1.1.1.- from Trypanosoma brucei brucei
30% identity, 94% coverage: 2:262/277 of query aligns to 5:257/276 of Q9GV41
P80874 Aldo-keto reductase YhdN; AKR11B; General stress protein 69; GSP69; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
34% identity, 80% coverage: 9:229/277 of query aligns to 10:273/331 of P80874
Sites not aligning to the query:
- 280:282 binding
- 286 binding
1pz1A Structure of NADPH-dependent family 11 aldo-keto reductase akr11b(holo) (see paper)
33% identity, 80% coverage: 9:229/277 of query aligns to 10:273/333 of 1pz1A
- active site: D52 (= D48), Y57 (= Y53), K90 (≠ P81), Q93 (vs. gap), H125 (= H111)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G19 (= G18), W21 (= W20), Q175 (= Q163), Y203 (= Y191), G204 (≠ S192), L206 (≠ I194), R208 (vs. gap), K214 (vs. gap)
Sites not aligning to the query:
3d3fA Crystal structure of yvgn and cofactor NADPH from bacillus subtilis (see paper)
34% identity, 99% coverage: 3:277/277 of query aligns to 7:274/275 of 3d3fA
- active site: D48 (= D48), Y53 (= Y53), K78 (= K78), H111 (= H111)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G22 (= G18), F24 (≠ W20), D48 (= D48), Y53 (= Y53), H111 (= H111), S140 (= S140), N141 (= N141), Q162 (= Q163), W188 (≠ Y191), S189 (= S192), P190 (= P193), L191 (≠ I194), Q193 (= Q196), L197 (= L200), I229 (= I233), K231 (= K235), S232 (≠ T236), K234 (≠ H238), R237 (= R241), E240 (= E244), N241 (= N245)
5az1A Crystal structure of aldo-keto reductase (akr2e5) complexed with nadph (see paper)
30% identity, 95% coverage: 5:266/277 of query aligns to 8:294/327 of 5az1A
- active site: D53 (= D48), Y58 (= Y53), K87 (= K78), H120 (= H111)
- binding calcium ion: R79 (= R70), L111 (≠ T102), D112 (= D103), H113 (≠ R104)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G21 (= G18), T22 (= T19), W23 (= W20), D53 (= D48), Y58 (= Y53), H120 (= H111), Q180 (= Q163), Y206 (= Y191), S207 (= S192), P208 (= P193), F209 (≠ I194), V213 (vs. gap), S215 (≠ E195), R216 (≠ Q196), T243 (≠ V217), I258 (= I233), P259 (= P234), K260 (= K235), T261 (= T236), V262 (≠ S237), T263 (≠ H238), R266 (= R241), E269 (= E244), N270 (= N245)
2wzmA Crystal structure of a mycobacterium aldo-keto reductase in its apo and liganded form (see paper)
29% identity, 95% coverage: 1:262/277 of query aligns to 2:256/274 of 2wzmA
- active site: D44 (= D48), Y49 (= Y53), K74 (= K78), H107 (= H111)
- binding [(2r,3r,4r,5r)-5-(6-amino-9h-purin-9-yl)-3-hydroxy-4-(phosphonooxy)tetrahydrofuran-2-yl]methyl [(2r,3s,4s)-3,4-dihydroxytetrahydrofuran-2-yl]methyl dihydrogen diphosphate: Y186 (= Y191), G187 (≠ S192), P188 (= P193), L189 (≠ I194), G190 (≠ E195), V191 (≠ Q196), G192 (≠ A197), L195 (= L200), A212 (≠ V217), I227 (= I233), R229 (≠ K235), S230 (≠ T236), R235 (= R241), N239 (= N245)
Sites not aligning to the query:
Query Sequence
>RR42_RS17795 FitnessBrowser__Cup4G11:RR42_RS17795
MKTVSLPGGESVAALGMGTWNMGDQPAARAEELATLRLGLDLGLTLIDTAEMYGDGRSEE
LVGEAIAGRRDEVFLVSKVYPHNAGRTGAVAACERSLRRLGTDRLDLYLLHWRGGVPLAE
TMEAFMALRKAGKIRYFGVSNLDLDDMRALWRVPGGKEVAANQLLYNLTRRGIEWDLLPW
LREHGVPLMAYSPIEQATLLRNPRLAGFAKKHGISPVQAALGWLLAQQGVIAIPKTSHRE
RLRENHGALALRLSAQQLAELDAAFQPPDGPHPLAML
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory