SitesBLAST
Comparing RR42_RS18515 FitnessBrowser__Cup4G11:RR42_RS18515 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WP23 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
34% identity, 98% coverage: 5:267/269 of query aligns to 1:243/245 of P9WP23
- K9 (≠ T13) mutation to A: Increases the nucleotide specificity from 6:1 for the wild-type enzyme to 34:1, due to a 4-fold decrease in NADPH affinity while the affinity for NADH remains nearly unchanged.
- K11 (≠ W15) mutation to A: 2.8-fold increase in catalytic activity with NADH as substrate, while the affinity for NADH is essentially unaffected. 70-fold decrease in affinity for NADPH, causing the nucleotide specificity to increase from 6:1 for the wild-type enzyme to 187:1.
- KV 11:12 (≠ WA 15:16) binding ; binding
- D33 (≠ S37) binding
- GTT 75:77 (≠ GTS 99:101) binding ; binding
- APNF 102:105 (≠ CGNF 125:128) binding ; binding
- K136 (= K159) binding ; binding
5ugvA Dapb from mycobacterium tuberculosis (see paper)
34% identity, 98% coverage: 5:267/269 of query aligns to 2:244/245 of 5ugvA
5tjzA Structure of 4-hydroxytetrahydrodipicolinate reductase from mycobacterium tuberculosis with NADPH and 2,6 pyridine dicarboxylic acid (see paper)
34% identity, 98% coverage: 5:267/269 of query aligns to 2:244/245 of 5tjzA
- active site: H133 (≠ A155), K137 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), G11 (= G14), K12 (≠ W15), V13 (≠ A16), D34 (≠ S37), A35 (= A41), F53 (≠ Y76), T54 (= T77), G76 (= G99), T77 (= T100), T78 (≠ S101), P104 (≠ G126), N105 (= N127), F106 (= F128), F218 (≠ Y241)
- binding pyridine-2,6-dicarboxylic acid: T78 (≠ S101), P104 (≠ G126), H134 (≠ K156), K137 (= K159), S142 (= S164), G143 (= G165), T144 (= T166), A193 (≠ L215)
1p9lA Structure of m. Tuberculosis dihydrodipicolinate reductase in complex with nadh and 2,6 pdc (see paper)
34% identity, 98% coverage: 5:267/269 of query aligns to 1:243/245 of 1p9lA
- active site: H132 (≠ A155), K136 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G7 (= G11), G10 (= G14), K11 (≠ W15), V12 (≠ A16), D33 (≠ S37), A34 (= A41), F52 (≠ Y76), T53 (= T77), V57 (≠ I81), G75 (= G99), T77 (≠ S101), P103 (≠ G126), N104 (= N127), F105 (= F128), F217 (≠ Y241)
- binding pyridine-2,6-dicarboxylic acid: H133 (≠ K156), K136 (= K159), S141 (= S164), G142 (= G165), T143 (= T166), A192 (≠ L215)
1c3vA Dihydrodipicolinate reductase from mycobacterium tuberculosis complexed with NADPH and pdc (see paper)
34% identity, 98% coverage: 5:267/269 of query aligns to 1:243/245 of 1c3vA
- active site: H132 (≠ A155), K136 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: K9 (≠ T13), G10 (= G14), K11 (≠ W15), V12 (≠ A16), D33 (≠ S37), A34 (= A41), F52 (≠ Y76), T53 (= T77), V57 (≠ I81), G75 (= G99), T77 (≠ S101), P103 (≠ G126), N104 (= N127), F217 (≠ Y241)
- binding pyridine-2,6-dicarboxylic acid: T77 (≠ S101), N104 (= N127), K136 (= K159), S141 (= S164), G142 (= G165), T143 (= T166), A192 (≠ L215)
1yl5A Crystal structure of mycobacterium tuberculosis dihydrodipicolinate reductase (rv2773c) (crystal form a) (see paper)
34% identity, 97% coverage: 6:267/269 of query aligns to 4:245/247 of 1yl5A
5z2fA NADPH/pda bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
32% identity, 97% coverage: 5:266/269 of query aligns to 3:265/265 of 5z2fA
- binding nadp nicotinamide-adenine-dinucleotide phosphate: R11 (≠ T13), G12 (= G14), K13 (≠ W15), M14 (≠ A16), D35 (≠ S37), H36 (≠ R38), K37 (≠ G39), L76 (≠ Y76), T77 (= T77), G99 (= G99), T100 (= T100), T101 (≠ S101), P126 (≠ G126), N127 (= N127), F128 (= F128)
- binding pyridine-2,6-dicarboxylic acid: P126 (≠ G126), H155 (≠ A155), H156 (≠ K156), K159 (= K159), S164 (= S164), G165 (= G165), T166 (= T166), A215 (≠ L215)
5z2eA Dipicolinate bound dihydrodipicolinate reductase from paenisporosarcina sp. Tg-14 (see paper)
32% identity, 97% coverage: 5:266/269 of query aligns to 3:265/265 of 5z2eA
5wolA Crystal structure of dihydrodipicolinate reductase dapb from coxiella burnetii
30% identity, 97% coverage: 5:266/269 of query aligns to 2:230/230 of 5wolA
- active site: H133 (≠ A155), K137 (= K159)
- binding pyridine-2-carboxylic acid: P104 (≠ G126), T144 (= T166), K147 (≠ E169)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: N7 (≠ G10), G11 (= G14), K12 (≠ W15), M13 (≠ A16), G34 (≠ S37), R35 (= R38), F54 (≠ Y76), T55 (= T77), T56 (≠ K78), S59 (≠ I81), G77 (= G99), T78 (= T100), T79 (≠ S101), P104 (≠ G126), N105 (= N127), F106 (= F128)
5eesA Crystal structure of dapb in complex with NADP+ from corynebacterium glutamicum (see paper)
31% identity, 97% coverage: 5:266/269 of query aligns to 2:245/247 of 5eesA
- active site: H133 (≠ A155), K137 (= K159)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G8 (= G11), G11 (= G14), R12 (≠ W15), V13 (≠ A16), G34 (= G56), V35 (= V57), F53 (≠ Y76), T54 (= T77), G76 (= G99), T78 (≠ S101), P104 (≠ G126), N105 (= N127), F106 (= F128), F220 (≠ Y241)
- binding sulfate ion: H134 (≠ K156), K137 (= K159), K137 (= K159), G143 (= G165), T144 (= T166)
5eerA Crystal structure of dapb from corynebacterium glutamicum (see paper)
31% identity, 97% coverage: 5:266/269 of query aligns to 2:245/247 of 5eerA
5tejB Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
29% identity, 60% coverage: 5:166/269 of query aligns to 2:166/269 of 5tejB
- active site: H155 (≠ A155), K159 (= K159)
- binding 2,5 Furan Dicarboxylic Acid: T100 (≠ S101), H156 (≠ K156), K159 (= K159), S164 (= S164), G165 (= G165), T166 (= T166)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), R12 (≠ W15), M13 (≠ A16), E34 (≠ S37), R35 (= R38), F75 (≠ Y76), T76 (= T77), S80 (≠ I81), G98 (= G99), T100 (≠ S101), P123 (≠ G126), N124 (= N127), Y125 (≠ F128)
Sites not aligning to the query:
5tejA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,5 furan dicarboxylic and nadh (see paper)
29% identity, 60% coverage: 5:166/269 of query aligns to 2:166/269 of 5tejA
- active site: H155 (≠ A155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), R12 (≠ W15), M13 (≠ A16), E34 (≠ S37), R35 (= R38), F75 (≠ Y76), T76 (= T77), S80 (≠ I81), G98 (= G99), T100 (≠ S101), P123 (≠ G126)
5temA Structure of 4-hydroxy-tetrahydrodipicolinate reductase from vibrio vulnificus with 2,6 pyridine dicarboxylic and nadh (see paper)
29% identity, 60% coverage: 5:166/269 of query aligns to 2:166/266 of 5temA
- active site: H155 (≠ A155), K159 (= K159)
- binding nicotinamide-adenine-dinucleotide: G8 (= G11), G11 (= G14), R12 (≠ W15), M13 (≠ A16), E34 (≠ S37), R35 (= R38), F75 (≠ Y76), T76 (= T77), S80 (≠ I81), G98 (= G99), T100 (≠ S101), P123 (≠ G126), N124 (= N127), Y125 (≠ F128)
- binding pyridine-2,6-dicarboxylic acid: T100 (≠ S101), P123 (≠ G126), H156 (≠ K156), K159 (= K159), S164 (= S164), G165 (= G165), T166 (= T166)
Sites not aligning to the query:
4ywjA Crystal structure of 4-hydroxy-tetrahydrodipicolinate reductase (htpa reductase) from pseudomonas aeruginosa
31% identity, 61% coverage: 70:234/269 of query aligns to 70:234/268 of 4ywjA
Sites not aligning to the query:
P04036 4-hydroxy-tetrahydrodipicolinate reductase; HTPA reductase; EC 1.17.1.8 from Escherichia coli (strain K12) (see 3 papers)
31% identity, 61% coverage: 4:166/269 of query aligns to 5:170/273 of P04036
- G12 (= G11) binding
- GRM 15:17 (≠ GWA 14:16) binding
- RM 16:17 (≠ WA 15:16) binding
- E38 (≠ S37) binding
- R39 (= R38) binding
- TR 80:81 (≠ TK 77:78) binding
- GTT 102:104 (≠ GTS 99:101) binding ; binding
- AA-NF 126:129 (≠ ACGNF 124:128) binding
- F129 (= F128) binding
- H159 (≠ A155) mutation H->A,Q: 135 to 200-fold reduction in catalytic activity.
- K163 (= K159) binding ; mutation K->A,C,Q: 625 to 830-fold reduction in catalytic activity.
Sites not aligning to the query:
1arzB Escherichia coli dihydrodipicolinate reductase in complex with nadh and 2,6 pyridine dicarboxylate (see paper)
31% identity, 61% coverage: 4:166/269 of query aligns to 1:166/269 of 1arzB
- active site: H155 (≠ A155), K159 (= K159)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G8 (= G11), G10 (≠ T13), G11 (= G14), R12 (≠ W15), M13 (≠ A16), E34 (≠ S37), F75 (≠ Y76), T76 (= T77), R77 (≠ K78), G80 (≠ I81), H84 (≠ N85), G98 (= G99), T100 (≠ S101), A123 (≠ C125), N124 (= N127), F125 (= F128)
- binding pyridine-2,6-dicarboxylic acid: T100 (≠ S101), H156 (≠ K156), K159 (= K159), S164 (= S164), G165 (= G165), T166 (= T166)
Sites not aligning to the query:
1drwA Escherichia coli dhpr/nhdh complex (see paper)
31% identity, 61% coverage: 4:166/269 of query aligns to 4:169/272 of 1drwA
- active site: H158 (≠ A155), K162 (= K159)
- binding nicotinamide purin-6-ol-dinucleotide: G11 (= G11), G14 (= G14), R15 (≠ W15), M16 (≠ A16), E37 (≠ S37), R38 (= R38), F78 (≠ Y76), T79 (= T77), R80 (≠ K78), G101 (= G99), T102 (= T100), T103 (≠ S101), A126 (≠ C125), N127 (= N127), F128 (= F128)
Sites not aligning to the query:
1dihA Three-dimensional structure of e. Coli dihydrodipicolinate reductase (see paper)
31% identity, 61% coverage: 4:166/269 of query aligns to 4:169/272 of 1dihA
- active site: H158 (≠ A155), K162 (= K159)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G11 (= G11), G14 (= G14), R15 (≠ W15), M16 (≠ A16), R38 (= R38), F78 (≠ Y76), T79 (= T77), R80 (≠ K78), G83 (≠ I81), G101 (= G99), T103 (≠ S101), N127 (= N127), F128 (= F128)
Sites not aligning to the query:
1drvA Escherichia coli dhpr/acnadh complex (see paper)
31% identity, 61% coverage: 4:166/269 of query aligns to 2:167/270 of 1drvA
- active site: H156 (≠ A155), K160 (= K159)
- binding 3-acetylpyridine adenine dinucleotide: G9 (= G11), G12 (= G14), R13 (≠ W15), M14 (≠ A16), E35 (≠ S37), F76 (≠ Y76), T77 (= T77), R78 (≠ K78), G81 (≠ I81), G99 (= G99), A124 (≠ C125), F126 (= F128)
Sites not aligning to the query:
Query Sequence
>RR42_RS18515 FitnessBrowser__Cup4G11:RR42_RS18515
MSNRIRVAVGGVTGWAGGELARGVAHADDMTLVAGLSRGAAGQALAALTAHKGTPGVAVA
SIDELAQGAFDVYVEYTKPDIAKRNILQALAKGAHVVVGTSGLSDEDYAEIDAAARQARR
GVLACGNFAITVVLLQKFAEMAARHLEHWEIIDYAKAGKIDVPSGTVRELAYRLGQVREA
RQAVPIDQVKGPKETRGATMSGSQVHAVRLPGYQLGVEVIFGADGQRLHLKHESGDGSKP
YVSGALLAIRKVHALTGLVRGLDKVMEGL
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory