Comparing RR42_RS23435 FitnessBrowser__Cup4G11:RR42_RS23435 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3dr2A Structural and functional analyses of xc5397 from xanthomonas campestris: a gluconolactonase important in glucose secondary metabolic pathways (see paper)
42% identity, 83% coverage: 44:307/317 of query aligns to 43:296/299 of 3dr2A
3e5zA X-ray structure of the putative gluconolactonase in protein family pf08450. Northeast structural genomics consortium target drr130.
37% identity, 93% coverage: 18:313/317 of query aligns to 2:287/290 of 3e5zA
Q9A9Z1 D-xylonolactone lactonase; Xylono-1,5-lactonase; EC 3.1.1.110 from Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) (see paper)
29% identity, 81% coverage: 46:301/317 of query aligns to 17:253/289 of Q9A9Z1
7pldB Caulobacter crescentus xylonolactonase with (r)-4-hydroxy-2- pyrrolidone (see paper)
29% identity, 81% coverage: 46:301/317 of query aligns to 17:253/289 of 7pldB
Sites not aligning to the query:
7plbB Caulobacter crescentus xylonolactonase with d-xylose (see paper)
29% identity, 81% coverage: 46:301/317 of query aligns to 17:253/289 of 7plbB
Sites not aligning to the query:
8dk0A Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound (s)gamma- valerolactone (see paper)
26% identity, 80% coverage: 38:290/317 of query aligns to 6:260/293 of 8dk0A
8djzA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound product (see paper)
26% identity, 80% coverage: 38:290/317 of query aligns to 6:260/293 of 8djzA
8djfA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound tetrahedral intermediate (see paper)
26% identity, 80% coverage: 38:290/317 of query aligns to 6:260/293 of 8djfA
7risA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound phosphate (see paper)
25% identity, 80% coverage: 38:290/317 of query aligns to 4:260/293 of 7risA
7rizA Crystal structure of rpa3624, a beta-propeller lactonase from rhodopseudomonas palustris, with active-site bound 2-hydroxyquinoline (see paper)
26% identity, 80% coverage: 38:290/317 of query aligns to 4:273/306 of 7rizA
4gncA Human smp30/gnl-1,5-ag complex (see paper)
25% identity, 81% coverage: 43:298/317 of query aligns to 14:259/298 of 4gncA
Sites not aligning to the query:
Q15493 Regucalcin; RC; Gluconolactonase; GNL; Senescence marker protein 30; SMP-30; EC 3.1.1.17 from Homo sapiens (Human) (see 2 papers)
25% identity, 81% coverage: 43:298/317 of query aligns to 15:260/299 of Q15493
3g4hA Crystal structure of human senescence marker protein-30 (zinc bound) (see paper)
25% identity, 81% coverage: 43:298/317 of query aligns to 13:258/297 of 3g4hA
4gnaA Mouse smp30/gnl-xylitol complex (see paper)
24% identity, 81% coverage: 43:298/317 of query aligns to 13:258/297 of 4gnaA
4gn9A Mouse smp30/gnl-glucose complex (see paper)
24% identity, 81% coverage: 43:298/317 of query aligns to 13:258/297 of 4gn9A
4gn8A Mouse smp30/gnl-1,5-ag complex (see paper)
24% identity, 81% coverage: 43:298/317 of query aligns to 13:258/297 of 4gn8A
Sites not aligning to the query:
4gn7A Mouse smp30/gnl (see paper)
24% identity, 81% coverage: 43:298/317 of query aligns to 13:258/297 of 4gn7A
Q9M1B4 Protein STRICTOSIDINE SYNTHASE-LIKE 13; AtSSL13; Protein LESS ADHERENT POLLEN 3; Strictosidine synthase 11; AtSS11 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 44% coverage: 115:253/317 of query aligns to 181:315/403 of Q9M1B4
Sites not aligning to the query:
Q9HDC9 Adipocyte plasma membrane-associated protein; Protein BSCv from Homo sapiens (Human) (see 4 papers)
30% identity, 43% coverage: 125:259/317 of query aligns to 193:325/416 of Q9HDC9
Sites not aligning to the query:
2dsoC Crystal structure of d138n mutant of drp35, a 35kda drug responsive protein from staphylococcus aureus (see paper)
26% identity, 71% coverage: 57:282/317 of query aligns to 55:271/323 of 2dsoC
Sites not aligning to the query:
>RR42_RS23435 FitnessBrowser__Cup4G11:RR42_RS23435
MQDASLSVEPIRYPDARIQALSPRFEKYHLPLAAIDRIATGGRWNEGPVWFGDARCLLWS
DVPNNRILRWDEETGNTTIFRKPSNNANGNTRDRQGRLVTCEHGGRRVTRTEYDGSITVL
ADQYDGKPLNSPNDVVVKSDGSVWFTDPPFGIVGFYQGEKAVAELPERVYRIDPHTGELS
VVADDVSGPNGLAFSPDEKLLYVIESRTRPRRIRAFHVSGDGESLTDSKVLIDAGPGTPD
GFRVDVDGNLWCGWGMGTPELDGVRVFAPDGEAIGHIGLPERCANLCFGGRHRNRLFMAS
CTSIYALYVNTQGAIGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory