Comparing RR42_RS24545 FitnessBrowser__Cup4G11:RR42_RS24545 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 9 hits to proteins with known functional sites (download)
Q9Y7Q9 Probable metabolite transporter C2H8.02 from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
26% identity, 30% coverage: 69:231/546 of query aligns to 98:268/583 of Q9Y7Q9
Sites not aligning to the query:
Q8NLB7 Gentisate transporter from Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) (see paper)
24% identity, 51% coverage: 23:303/546 of query aligns to 52:315/444 of Q8NLB7
Sites not aligning to the query:
O42885 Putative inorganic phosphate transporter C8E4.01c from Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast) (see paper)
27% identity, 28% coverage: 69:221/546 of query aligns to 108:268/572 of O42885
Sites not aligning to the query:
4gc0A The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to 6-bromo-6-deoxy-d-glucose (see paper)
25% identity, 36% coverage: 122:320/546 of query aligns to 129:353/475 of 4gc0A
Sites not aligning to the query:
4gbzA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-glucose (see paper)
25% identity, 36% coverage: 122:320/546 of query aligns to 129:353/475 of 4gbzA
Sites not aligning to the query:
4gbyA The structure of the mfs (major facilitator superfamily) proton:xylose symporter xyle bound to d-xylose (see paper)
25% identity, 36% coverage: 122:320/546 of query aligns to 129:353/475 of 4gbyA
Sites not aligning to the query:
P0AGF4 D-xylose-proton symporter; D-xylose transporter from Escherichia coli (strain K12) (see paper)
25% identity, 36% coverage: 122:320/546 of query aligns to 133:357/491 of P0AGF4
Sites not aligning to the query:
A0A0H2VG78 Glucose transporter GlcP; Glucose/H(+) symporter from Staphylococcus epidermidis (strain ATCC 12228 / FDA PCI 1200) (see paper)
30% identity, 29% coverage: 75:235/546 of query aligns to 63:212/446 of A0A0H2VG78
Sites not aligning to the query:
O08966 Solute carrier family 22 member 1; Organic cation transporter 1; mOCT1 from Mus musculus (Mouse) (see paper)
29% identity, 29% coverage: 69:226/546 of query aligns to 162:299/556 of O08966
Sites not aligning to the query:
>RR42_RS24545 FitnessBrowser__Cup4G11:RR42_RS24545
MAHGPDATSPMSRAIWAASIGTIFEWYEFALYGALASVLADKFFAGVDPSTAFIFALLTF
AVGFMMRPLGALVFGRIGDMIGRKRTFMITICMMGGATIGVGCLPTYASAGIVSPIALLC
LRILQGFSAGGEYTGALTYVAEYSPGRRRGLNMSWTTASSTVGLLLSFLVILASRTIAGD
SFDDWGWRLPFLAASVMLLVSLLLRVRMDESPAFRKLRSANKLSKAPLRDALLDRANLGR
IVIAFALCAGMTSMYYMAALYPTFFLTKSLKVDPTTVNTVVLLATALCVPVFPLAGWACD
RFGRKPVLLVGFLTSALLAFPVFKGLVIYANHALAAAQAKAPISIEVDRAACSLMFNPLG
NRKFASSCDLVKQALANAGASYQIIDAAPGTTARIRIGDDVLDAYDAGGMSADQAKAQSS
QLSQALHAALEKYSYPGKSDPKAFNVTVVLLLLALFFASSILTVMTIGPALVEMFPTRIR
YTSMGVPYNLATGWVGGLLPTFVFAIAAQTGNSLCGLWYPVGWTILSLVALCFFRETRDI
DIAADA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory