SitesBLAST
Comparing RR42_RS24640 FitnessBrowser__Cup4G11:RR42_RS24640 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
8p84B X-ray structure of thermoanaerobacterales bacterium monoamine oxidase (see paper)
39% identity, 88% coverage: 55:493/498 of query aligns to 4:449/450 of 8p84B
- binding flavin-adenine dinucleotide: V9 (≠ I60), G10 (= G61), G12 (= G63), A14 (= A65), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), T42 (= T94), G56 (= G109), Q57 (= Q110), W58 (= W111), V234 (= V280), V262 (≠ L309), W383 (= W427), W388 (= W433), C392 (= C437), Y393 (≠ V438), G420 (= G464), T421 (= T465), G429 (= G473), Y430 (= Y474), I431 (≠ M475), A434 (= A478)
- binding magnesium ion: E125 (≠ K171), H188 (≠ N234)
3rhaA The crystal structure of oxidoreductase from arthrobacter aurescens
35% identity, 88% coverage: 56:492/498 of query aligns to 7:449/459 of 3rhaA
- active site: S62 (≠ G113), S197 (≠ D241), K295 (= K342)
- binding dihydroflavine-adenine dinucleotide: V11 (≠ I60), G12 (= G61), G14 (= G63), P15 (≠ L64), S16 (≠ A65), E35 (= E85), A36 (= A86), R37 (= R87), G42 (= G92), R43 (= R93), G57 (= G108), G58 (= G109), Q59 (= Q110), W60 (= W111), P234 (= P279), V235 (= V280), V263 (≠ L309), W384 (= W427), W389 (= W433), Y394 (≠ C437), S421 (≠ G464), S422 (≠ T465), Q430 (≠ G473), H431 (≠ Y474), V432 (≠ M475)
P19643 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Rattus norvegicus (Rat) (see paper)
31% identity, 88% coverage: 56:493/498 of query aligns to 6:454/520 of P19643
- I199 (≠ E244) mutation to F: Increased affinity for serotonin and tyramine.
1o5wC The structure basis of specific recognitions for substrates and inhibitors of rat monoamine oxidase a (see paper)
30% identity, 88% coverage: 54:493/498 of query aligns to 4:454/512 of 1o5wC
- active site: G62 (= G113), R197 (= R242), K296 (≠ R341)
- binding flavin-adenine dinucleotide: I10 (= I60), G13 (= G63), S15 (≠ A65), E34 (= E85), A35 (= A86), R36 (= R87), G41 (= G92), R42 (= R93), G57 (= G108), G58 (= G109), A59 (≠ Q110), Y60 (≠ W111), P234 (= P279), V235 (= V280), I264 (≠ L309), W388 (= W427), Y393 (≠ W433), C397 (= C437), Y398 (≠ V438), G425 (= G464), T426 (= T465), G434 (= G473), Y435 (= Y474), M436 (= M475)
- binding n-[3-(2,4-dichlorophenoxy)propyl]-n-methyl-n-prop-2-ynylamine: I171 (= I215), F199 (≠ E244), Q206 (= Q251), C314 (≠ W360), I316 (≠ F362), I326 (≠ W370), T327 (≠ A371), Y398 (≠ V438), Y435 (= Y474)
P21397 Amine oxidase [flavin-containing] A; Monoamine oxidase type A; MAO-A; EC 1.4.3.21; EC 1.4.3.4 from Homo sapiens (Human) (see 6 papers)
31% identity, 88% coverage: 54:493/498 of query aligns to 13:463/527 of P21397
- D15 (≠ E56) to E: in a breast cancer sample; somatic mutation
- C165 (≠ G208) mutation to S: No loss of activity.
- E188 (≠ R223) to K: in dbSNP:rs77698881
- C266 (≠ A302) to F: found in a family with Brunner syndrome-like behavioral disturbances; likely pathogenic; reduced activity; dbSNP:rs587777457; mutation to S: No loss of activity.
- C306 (≠ T343) mutation to S: No loss of activity.
- C321 (≠ N358) mutation to S: No loss of activity.
- C323 (≠ W360) mutation to S: No loss of activity.
- C374 (≠ S405) mutation to S: Complete loss of activity.
- C398 (≠ L428) mutation to S: No loss of activity.
- C406 (= C437) modified: S-8alpha-FAD cysteine; mutation to S: Complete loss of activity.
Sites not aligning to the query:
- 1 modified: N-acetylmethionine
2z5xA Crystal structure of human monoamine oxidase a with harmine (see paper)
31% identity, 88% coverage: 54:493/498 of query aligns to 2:452/513 of 2z5xA
- active site: G60 (= G113), R195 (= R242), K294 (= K342)
- binding decyl(dimethyl)phosphine oxide: V104 (= V150), W105 (≠ D151), Y110 (≠ F156)
- binding flavin-adenine dinucleotide: I8 (= I60), G9 (= G61), G11 (= G63), I12 (≠ L64), S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), A57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), L266 (= L313), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (≠ V438), G423 (= G464), T424 (= T465), G432 (= G473), Y433 (= Y474), M434 (= M475)
- binding 7-methoxy-1-methyl-9h-beta-carboline: I169 (= I215), F197 (≠ E244), Q204 (= Q251), I324 (≠ W370), L326 (≠ Y372), F341 (= F387), Y396 (≠ V438)
Sites not aligning to the query:
4i58A Cyclohexylamine oxidase from brevibacterium oxydans ih-35a (see paper)
33% identity, 86% coverage: 55:484/498 of query aligns to 3:440/451 of 4i58A
- active site: G61 (= G113), S195 (≠ R242), K294 (= K342)
- binding flavin-adenine dinucleotide: G9 (= G61), G11 (= G63), I12 (≠ L64), S13 (≠ A65), E32 (= E85), A33 (= A86), G39 (= G92), R40 (= R93), G57 (= G109), M58 (≠ Q110), F59 (≠ W111), V234 (= V280), M262 (≠ L309), Y292 (vs. gap), W383 (= W427), P393 (≠ C437), G420 (= G464), T421 (= T465), G429 (= G473), Y430 (= Y474), M431 (= M475)
2yg4A Structure-based redesign of cofactor binding in putrescine oxidase: wild type bound to putrescine (see paper)
33% identity, 87% coverage: 56:486/498 of query aligns to 6:443/449 of 2yg4A
- active site: S61 (≠ G113), S196 (≠ Y240), K295 (= K342)
- binding 4-hydroxybutan-1-aminium: G171 (= G218), E323 (≠ W370), Y394 (≠ C437)
- binding flavin-adenine dinucleotide: V10 (≠ I60), G11 (= G61), G13 (= G63), P14 (≠ L64), S15 (≠ A65), E34 (= E85), A35 (= A86), R36 (= R87), G41 (= G92), R42 (= R93), G56 (= G108), G57 (= G109), Q58 (= Q110), W59 (= W111), V234 (= V280), V263 (≠ L309), W384 (= W427), W389 (= W433), Y394 (≠ C437), C421 (≠ G464), S422 (≠ T465), Q430 (≠ G473), H431 (≠ Y474), V432 (≠ M475)
2yg3B Structure-based redesign of cofactor binding in putrescine oxidase: wild type enzyme (see paper)
33% identity, 87% coverage: 56:486/498 of query aligns to 6:443/450 of 2yg3B
- active site: S61 (≠ G113), S196 (≠ Y240), K295 (= K342)
- binding flavin-adenine dinucleotide: V10 (≠ I60), G11 (= G61), G13 (= G63), P14 (≠ L64), S15 (≠ A65), E34 (= E85), A35 (= A86), R36 (= R87), G41 (= G92), R42 (= R93), G56 (= G108), G57 (= G109), Q58 (= Q110), W59 (= W111), V234 (= V280), V263 (≠ L309), W384 (= W427), W389 (= W433), Y394 (≠ C437), C421 (≠ G464), S422 (≠ T465), Q430 (≠ G473), H431 (≠ Y474), V432 (≠ M475), A435 (= A478)
P56560 Amine oxidase [flavin-containing] B; Monoamine oxidase type B; MAO-B; EC 1.4.3.21; EC 1.4.3.4 from Bos taurus (Bovine) (see paper)
31% identity, 86% coverage: 64:493/498 of query aligns to 14:454/520 of P56560
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
6lqlA Complex structure of chao with product from erythrobacteraceae bacterium (see paper)
33% identity, 88% coverage: 56:494/498 of query aligns to 5:450/450 of 6lqlA
- binding 1-[(4-methoxyphenyl)methyl]-3,4,5,6,7,8-hexahydroisoquinoline: W60 (= W111), I170 (= I215), I198 (≠ E244), Q205 (= Q251), L292 (vs. gap), W322 (= W370), F324 (≠ Y372), F339 (= F387), Y430 (= Y474)
- binding flavin-adenine dinucleotide: G10 (= G61), G12 (= G63), P13 (≠ L64), S14 (≠ A65), E33 (= E85), A34 (= A86), K35 (≠ R87), G40 (= G92), R41 (= R93), G57 (= G108), G58 (= G109), W60 (= W111), P233 (= P279), V234 (= V280), A266 (≠ L313), W383 (= W427), G420 (= G464), T421 (= T465), G429 (= G473), Y430 (= Y474), I431 (≠ M475), A434 (= A478)
6lqcA Crystal structure of cyclohexylamine oxidase from erythrobacteraceae bacterium (see paper)
33% identity, 88% coverage: 56:494/498 of query aligns to 5:450/450 of 6lqcA
- binding flavin-adenine dinucleotide: G10 (= G61), G12 (= G63), P13 (≠ L64), S14 (≠ A65), E33 (= E85), A34 (= A86), K35 (≠ R87), G40 (= G92), R41 (= R93), G58 (= G109), W60 (= W111), P233 (= P279), V234 (= V280), A266 (≠ L313), W383 (= W427), P393 (vs. gap), G420 (= G464), G429 (= G473), Y430 (= Y474), I431 (≠ M475), A434 (= A478)
7zw3AAA Amine oxidase [flavin-containing] B (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 13:453/500 of 7zw3AAA
- binding 1-(8-oxidanylquinolin-2-yl)-N-(phenylmethyl)methanimine oxide: W118 (≠ A163), L163 (≠ G208), F167 (≠ G212), L170 (≠ I215), I198 (≠ E244), Q205 (= Q251), Y325 (≠ W370), Y397 (≠ V438)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ V197), K153 (= K198)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), P233 (= P279), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (≠ V438), G424 (= G464), T425 (= T465), G433 (= G473), Y434 (= Y474), M435 (= M475)
Sites not aligning to the query:
6yt2A Crystal structure of human monoamine oxidase b in complex with diphenylene iodonium (dpi) (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 13:453/500 of 6yt2A
- active site: G61 (= G113), R196 (= R242), K295 (= K342)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ V197), K153 (= K198), W156 (≠ I201)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), P233 (= P279), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (≠ V438), G424 (= G464), T425 (= T465), G433 (= G473), Y434 (= Y474), M435 (= M475), A438 (= A478)
- binding benzo[b][1]benziodole: Y59 (≠ W111), L170 (≠ I215), C171 (≠ T216), I197 (≠ L243), I198 (≠ E244), Q205 (= Q251), Y325 (≠ W370), F342 (= F387)
Sites not aligning to the query:
6fw0A Crystal structure of human monoamine oxidase b (mao b) in complex with chlorophenyl-chromone-carboxamide (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 13:453/500 of 6fw0A
- active site: G61 (= G113), R196 (= R242), K295 (= K342)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ V197), K153 (= K198), W156 (≠ I201)
- binding ~{N}-(3-chlorophenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (≠ G212), L170 (≠ I215), C171 (≠ T216), I198 (≠ E244), Q205 (= Q251), Y325 (≠ W370), F342 (= F387), Y397 (≠ V438)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), P233 (= P279), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (≠ V438), G424 (= G464), T425 (= T465), G433 (= G473), Y434 (= Y474), M435 (= M475)
Sites not aligning to the query:
6fvzA Crystal structure of human monoamine oxidase b (mao b) in complex with dimethylphenyl-chromone-carboxamide (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 13:453/500 of 6fvzA
- active site: G61 (= G113), R196 (= R242), K295 (= K342)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D152 (≠ V197), W156 (≠ I201)
- binding ~{N}-(3,4-dimethylphenyl)-4-oxidanylidene-chromene-3-carboxamide: F167 (≠ G212), L170 (≠ I215), I198 (≠ E244), Q205 (= Q251), I315 (≠ F362), Y325 (≠ W370), F342 (= F387), Y397 (≠ V438)
- binding flavin-adenine dinucleotide: S14 (≠ A65), L32 (= L84), E33 (= E85), A34 (= A86), R35 (= R87), G40 (= G92), R41 (= R93), G56 (= G108), G57 (= G109), S58 (≠ Q110), Y59 (≠ W111), P233 (= P279), V234 (= V280), I263 (≠ L309), W387 (= W427), Y392 (≠ W433), C396 (= C437), Y397 (≠ V438), G424 (= G464), T425 (= T465), G433 (= G473), Y434 (= Y474), M435 (= M475)
Sites not aligning to the query:
7p4hA Crystal structure of monoamine oxidase b in complex with inhibitor (+)-2 (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 12:452/499 of 7p4hA
- binding 3,4-dimethyl-7-[[(3~{S})-piperidin-3-yl]methoxy]chromen-2-one: Y58 (≠ W111), L169 (≠ I215), C170 (≠ T216), I197 (≠ E244), Q204 (= Q251), Y324 (≠ W370)
- binding flavin-adenine dinucleotide: S13 (≠ A65), L31 (= L84), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (≠ V438), G423 (= G464), T424 (= T465), G432 (= G473), Y433 (= Y474), M434 (= M475)
Sites not aligning to the query:
7p4fA Crystal structure of monoamine oxidase b in complex with inhibitor 1 (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 12:452/499 of 7p4fA
- binding 4-(hydroxymethyl)-7-[[4-[[methyl-(phenylmethyl)amino]methyl]phenyl]methoxy]chromen-2-one: Y58 (≠ W111), F101 (≠ H147), W117 (≠ A163), L162 (≠ G208), F166 (≠ G212), L169 (≠ I215), I197 (≠ E244), Q204 (= Q251), Y324 (≠ W370), F341 (= F387), Y396 (≠ V438), Y433 (= Y474)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ V197), K152 (= K198), W155 (≠ I201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), T41 (= T94), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (≠ V438), G423 (= G464), T424 (= T465), G432 (= G473), Y433 (= Y474), M434 (= M475)
Sites not aligning to the query:
6rleA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 97 (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 12:452/499 of 6rleA
- active site: G60 (= G113), R195 (= R242), K294 (= K342)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ V197), W155 (≠ I201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (≠ V438), G423 (= G464), T424 (= T465), G432 (= G473), Y433 (= Y474), M434 (= M475)
- binding 4-[2-(4-propan-2-ylphenyl)ethyl]-1-[(~{E})-prop-1-enyl]piperidine: F166 (≠ G212), L169 (≠ I215), I197 (≠ E244), Q204 (= Q251), Y324 (≠ W370), Y396 (≠ V438)
Sites not aligning to the query:
6rkpA Crystal structure of human monoamine oxidase b in complex with styrylpiperidine analogue 84 (see paper)
30% identity, 86% coverage: 64:493/498 of query aligns to 12:452/499 of 6rkpA
- active site: G60 (= G113), R195 (= R242), K294 (= K342)
- binding n-dodecyl-n,n-dimethyl-3-ammonio-1-propanesulfonate: D151 (≠ V197), W155 (≠ I201)
- binding flavin-adenine dinucleotide: S13 (≠ A65), E32 (= E85), A33 (= A86), R34 (= R87), G39 (= G92), R40 (= R93), G55 (= G108), G56 (= G109), S57 (≠ Q110), Y58 (≠ W111), P232 (= P279), V233 (= V280), I262 (≠ L309), W386 (= W427), Y391 (≠ W433), C395 (= C437), Y396 (≠ V438), G423 (= G464), T424 (= T465), G432 (= G473), Y433 (= Y474), M434 (= M475)
- binding 1-[(~{E})-prop-1-enyl]-4-[(~{E})-2-[4-(trifluoromethyl)phenyl]ethenyl]piperidine: P102 (≠ A148), L169 (≠ I215), I197 (≠ E244), Q204 (= Q251), I314 (≠ F362), Y324 (≠ W370), F341 (= F387), Y396 (≠ V438)
Sites not aligning to the query:
Query Sequence
>RR42_RS24640 FitnessBrowser__Cup4G11:RR42_RS24640
MDDIPTKRDETPEAAALTRRGFLGMAASVTAAATVAVLPKVASAAIAASDERDVLEVVVI
GAGLAGLTAARDLKRAGCESFVVLEARDRVGGRTLNHDLGNGYFSESGGQWIGPGQTAVA
DLARELGVGTFPTYWQGKTMMLAGDAHAAVDTEGGFGTDPKIAHELEELAKSVPCGAPWK
SPRAAEFDAMSVGDWLVKKNIANADQIGWSTGLAITGGASPARLSLLHWLSMVNSAECNY
DRLEAVKGGAQQTRISGGSQILSIKMAQALGDKVRLSTPVLRVENWQNGPVAIHTANGVV
RARNVIVALAPMLCNQIAFDPPLPEKRHEMQRRWPAFAPGRKTTHVYKKAFWRDRGLNGW
IFQPGGPVLWAYDNSPEDVSFGVINAFVHISMLPADPKEAEAQLSQIYAQAFGDQALHPI
AFHQRDWLKADKWTLSCVSPMPPGFLTTYGEALHPSVGKLIWSGTETAEIWAGYMDGAVR
SGHKAALQALQAVAGREA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory