Comparing RR42_RS25025 FitnessBrowser__Cup4G11:RR42_RS25025 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1g9xB Characterization of the twinning structure of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 97% coverage: 8:255/256 of query aligns to 4:253/253 of 1g9xB
1g6hA Crystal structure of the adp conformation of mj1267, an atp-binding cassette of an abc transporter (see paper)
33% identity, 97% coverage: 8:255/256 of query aligns to 4:253/254 of 1g6hA
6mjpA Lptb(e163q)fgc from vibrio cholerae (see paper)
32% identity, 97% coverage: 8:255/256 of query aligns to 2:235/240 of 6mjpA
6s8nB Cryo-em structure of lptb2fgc in complex with lipopolysaccharide (see paper)
33% identity, 95% coverage: 14:255/256 of query aligns to 8:235/238 of 6s8nB
6s8gA Cryo-em structure of lptb2fgc in complex with amp-pnp (see paper)
33% identity, 95% coverage: 14:255/256 of query aligns to 8:235/238 of 6s8gA
6mhzA Vanadate trapped cryo-em structure of e.Coli lptb2fg transporter (see paper)
33% identity, 95% coverage: 14:255/256 of query aligns to 8:235/235 of 6mhzA
P04983 Ribose import ATP-binding protein RbsA; EC 7.5.2.7 from Escherichia coli (strain K12) (see paper)
28% identity, 95% coverage: 8:249/256 of query aligns to 4:234/501 of P04983
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
30% identity, 94% coverage: 7:247/256 of query aligns to 1:227/241 of 4u00A
6mbnA Lptb e163q in complex with atp (see paper)
33% identity, 95% coverage: 14:255/256 of query aligns to 9:236/241 of 6mbnA
6b89A E. Coli lptb in complex with adp and novobiocin (see paper)
33% identity, 94% coverage: 14:254/256 of query aligns to 8:234/234 of 6b89A
4p31A Crystal structure of a selenomethionine derivative of e. Coli lptb in complex with adp-magensium (see paper)
33% identity, 94% coverage: 14:254/256 of query aligns to 8:234/234 of 4p31A
6b8bA E. Coli lptb in complex with adp and a novobiocin derivative (see paper)
33% identity, 94% coverage: 14:253/256 of query aligns to 8:233/233 of 6b8bA
1ji0A Crystal structure analysis of the abc transporter from thermotoga maritima
30% identity, 93% coverage: 18:256/256 of query aligns to 16:239/240 of 1ji0A
3c4jA Abc protein artp in complex with atp-gamma-s
27% identity, 94% coverage: 8:247/256 of query aligns to 3:229/242 of 3c4jA
3c41J Abc protein artp in complex with amp-pnp/mg2+
27% identity, 94% coverage: 8:247/256 of query aligns to 3:229/242 of 3c41J
2olkA Abc protein artp in complex with adp-beta-s
27% identity, 94% coverage: 8:247/256 of query aligns to 3:229/242 of 2olkA
2oljA Abc protein artp in complex with adp/mg2+
27% identity, 94% coverage: 8:247/256 of query aligns to 3:229/242 of 2oljA
4ymuJ Crystal structure of an amino acid abc transporter complex with arginines and atps (see paper)
25% identity, 93% coverage: 8:244/256 of query aligns to 1:224/240 of 4ymuJ
6z5uK Cryo-em structure of the a. Baumannii mlabdef complex bound to appnhp (see paper)
32% identity, 90% coverage: 27:256/256 of query aligns to 21:241/253 of 6z5uK
Sites not aligning to the query:
7d0aB Acinetobacter mlafedb complex in adp-vanadate trapped vclose conformation (see paper)
32% identity, 91% coverage: 25:256/256 of query aligns to 21:243/263 of 7d0aB
>RR42_RS25025 FitnessBrowser__Cup4G11:RR42_RS25025
MNPTINPMLRLDEVARSFGGVPALSGLSLSAAPGTITGLIGPNGAGKSTVVNLVMGLLHL
SSGRVLLDGRDVSTMEASQLARAGVARTFQNIRLVPQATVLDNVLAGFHRHQTTGFWANL
LGLRAARAETAAHRAEAIALLERFGMAKLAQHRAGNLSYGHQRRIEMMRALAMKPRLLLL
DEPVAGMNDVEAASLGRIFQEVAAEGVAVLLIEHNMRFMTQVCSYLYVLASGREIAEGQP
EAVLQDPVVMQAYLGT
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory