Comparing RR42_RS26020 FitnessBrowser__Cup4G11:RR42_RS26020 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q9NQR4 Omega-amidase NIT2; Nitrilase homolog 2; EC 3.5.1.3 from Homo sapiens (Human) (see 2 papers)
28% identity, 85% coverage: 1:241/282 of query aligns to 1:257/276 of Q9NQR4
O25836 Formamidase; Formamide amidohydrolase; EC 3.5.1.49 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
28% identity, 88% coverage: 1:248/282 of query aligns to 11:281/334 of O25836
O25067 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Helicobacter pylori (strain ATCC 700392 / 26695) (Campylobacter pylori) (see paper)
25% identity, 79% coverage: 18:240/282 of query aligns to 33:267/339 of O25067
2e2lA Helicobacter pylori formamidase amif contains a fine-tuned cysteine- glutamate-lysine catalytic triad (see paper)
28% identity, 87% coverage: 4:248/282 of query aligns to 2:264/317 of 2e2lA
6ypaB The c146a variant of an amidase from pyrococcus horikoshii with bound glutaramide
31% identity, 73% coverage: 55:260/282 of query aligns to 67:266/269 of 6ypaB
Sites not aligning to the query:
7ovgA The c146a variant of an amidase from pyrococcus horikoshii with bound acetamide (see paper)
31% identity, 73% coverage: 55:260/282 of query aligns to 61:260/263 of 7ovgA
Sites not aligning to the query:
P11436 Aliphatic amidase; Acylamide amidohydrolase; EC 3.5.1.4 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
26% identity, 83% coverage: 5:239/282 of query aligns to 16:267/346 of P11436
3klcB Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 73% coverage: 55:260/282 of query aligns to 59:258/261 of 3klcB
Sites not aligning to the query:
3klcA Crystal structure of hyperthermophilic nitrilase (see paper)
29% identity, 73% coverage: 55:260/282 of query aligns to 59:258/261 of 3klcA
Sites not aligning to the query:
Q9UYV8 Nitrilase; PaNit; EC 3.5.5.1 from Pyrococcus abyssi (strain GE5 / Orsay) (see paper)
29% identity, 73% coverage: 55:260/282 of query aligns to 60:259/262 of Q9UYV8
5h8jB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with cadaverine (see paper)
27% identity, 62% coverage: 65:240/282 of query aligns to 74:271/297 of 5h8jB
Sites not aligning to the query:
5h8iC Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) in complex with n-(dihydroxymethyl)putrescine (see paper)
27% identity, 62% coverage: 65:240/282 of query aligns to 78:275/301 of 5h8iC
Sites not aligning to the query:
Q9RQ17 Aliphatic amidase; Acylamide amidohydrolase; Wide spectrum amidase; EC 3.5.1.4 from Geobacillus stearothermophilus (Bacillus stearothermophilus) (see paper)
26% identity, 79% coverage: 18:241/282 of query aligns to 33:269/348 of Q9RQ17
Sites not aligning to the query:
4gylA The e142l mutant of the amidase from geobacillus pallidus showing the result of michael addition of acrylamide at the active site cysteine (see paper)
26% identity, 79% coverage: 18:241/282 of query aligns to 33:269/340 of 4gylA
5h8lB Crystal structure of medicago truncatula n-carbamoylputrescine amidohydrolase (mtcpa) c158s mutant in complex with putrescine (see paper)
27% identity, 62% coverage: 65:240/282 of query aligns to 75:272/298 of 5h8lB
Sites not aligning to the query:
Q94JV5 Deaminated glutathione amidase, chloroplastic/cytosolic; dGSH amidase; Nitrilase-like protein 2; Protein nitrilase 1 homolog; AtNit1; Protein Nit1 homolog; EC 3.5.1.128 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
27% identity, 68% coverage: 49:241/282 of query aligns to 86:295/307 of Q94JV5
Sites not aligning to the query:
4iztA The e41q mutant of the amidase from nesterenkonia sp. An1 showing covalent addition of the acetamide moiety of fluoroacetamide at the active site cysteine
29% identity, 71% coverage: 39:237/282 of query aligns to 45:255/263 of 4iztA
4izuA The e41q mutant of the amidase from nesterenkonia sp. An1 showing the result of michael addition of acrylamide at the active site cysteine
29% identity, 71% coverage: 39:237/282 of query aligns to 37:246/254 of 4izuA
Sites not aligning to the query:
Q44185 N-carbamoyl-D-amino acid hydrolase; D-N-alpha-carbamilase; EC 3.5.1.77 from Rhizobium radiobacter (Agrobacterium tumefaciens) (Agrobacterium radiobacter) (see paper)
27% identity, 66% coverage: 57:241/282 of query aligns to 72:285/304 of Q44185
5nybA A c145a mutant of nesterenkonia an1 amidase bound to adipamide
29% identity, 71% coverage: 39:237/282 of query aligns to 44:254/262 of 5nybA
>RR42_RS26020 FitnessBrowser__Cup4G11:RR42_RS26020
MKRFAVAGIQMPVSAFEENITQMNRYLAHVRHRFPWVDMVMFSELAAFGPSPAKAEEMPG
AAEARLCEMAAKYGLWLIPGSLFERRDGAIYNTAPVIDPAGNVVARFRKLFPFRPYEQGI
AAGSEFVVFDVPDAGRFGISICYDMWFPETTRTLVAMGAEVILHPTMTDTIDRDIELSIV
RASAATNQVYFFDINGVGDGGVGRSIVVDPAGYVLHEAGPGTAEIIPVEIDFEKVRRERE
RGLRGLGQPLKSFRDREVEFPVYQRNSGADAYLHTLGKLVKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory