Comparing RR42_RS27870 FitnessBrowser__Cup4G11:RR42_RS27870 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WNH5 4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase; 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; Meta-cleavage product hydrolase; MCP hydrolase; EC 3.7.1.17; EC 3.7.1.8 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 24:289/291 of P9WNH5
7zm4A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc31 (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 7zm4A
7zm3A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclipostin-like inhibitor cyc17 (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 7zm3A
7zm2A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc8b (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 7zm2A
7zm1A Crystal structure of hsad from mycobacterium tuberculosis in complex with cyclophostin-like inhibitor cyc7b (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 7zm1A
5jzsB Hsad bound to 3,5-dichloro-4-hydroxybenzoic acid (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 5jzsB
5jz9A Crystal structure of hsad bound to 3,5-dichloro-4- hydroxybenzenesulphonic acid (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/284 of 5jz9A
5jzbA Crystal structure of hsad bound to 3,5-dichlorobenzene sulphonamide (see paper)
31% identity, 88% coverage: 25:283/294 of query aligns to 18:281/282 of 5jzbA
2wugA Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopda (see paper)
31% identity, 89% coverage: 25:285/294 of query aligns to 18:283/283 of 2wugA
2wufB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with 4,9dsha (see paper)
31% identity, 88% coverage: 25:283/294 of query aligns to 18:281/282 of 2wufB
2wueB Crystal structure of s114a mutant of hsad from mycobacterium tuberculosis in complex with hopoda (see paper)
31% identity, 88% coverage: 25:283/294 of query aligns to 18:281/282 of 2wueB
2d0dA Crystal structure of a meta-cleavage product hydrolase (cumd) a129v mutant (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 2d0dA
1iunB Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal (see paper)
30% identity, 91% coverage: 22:290/294 of query aligns to 11:276/276 of 1iunB
1ukaA Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with (s)-2-methylbutyrate (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 1ukaA
1uk9A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with isovalerate (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 1uk9A
1uk8A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-valerate (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 1uk8A
1uk7A Crystal structure of a meta-cleavage product hydrolase (cumd) complexed with n-butyrate (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 1uk7A
1iupA Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant complexed with isobutyrates (see paper)
31% identity, 89% coverage: 22:283/294 of query aligns to 10:268/271 of 1iupA
2og1A Crystal structure of bphd, a c-c hydrolase from burkholderia xenovorans lb400 (see paper)
32% identity, 64% coverage: 96:283/294 of query aligns to 96:282/285 of 2og1A
Sites not aligning to the query:
P47229 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase; HOPDA hydrolase; 2,6-dioxo-6-phenylhexa-3-enoate hydrolase; EC 3.7.1.8 from Paraburkholderia xenovorans (strain LB400) (see paper)
32% identity, 64% coverage: 96:283/294 of query aligns to 97:283/286 of P47229
>RR42_RS27870 FitnessBrowser__Cup4G11:RR42_RS27870
MPFQSIWGELRGVSFSQGWLDAKGIRTRYLHAGSSGKPALILLHGVGGHAEAYVRNLQSH
AEHFDVWAIDMIGHGWTDKPAGGREISDYVDHVIRVMDTLGIARAAFSGESLGGWVAARL
AIDHPERVERLVLNTAGGSQADPVVMERLKTLSMRAVEEPGWDFIKARVQWLMADKAKAF
DDLIATRQAIYAQPGMVEAQRGNMVLQDMETRQRNILRAEHYGRIKAPTLVLWTSDDPTA
DVSEGRRIATMIPGALFTVMDGCGHWPQFEDADTFNRIHLNFLLGNAVPEATTV
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory