SitesBLAST
Comparing RR42_RS29350 FitnessBrowser__Cup4G11:RR42_RS29350 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q92R43 Aquaglyceroporin AqpS from Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
54% identity, 87% coverage: 4:213/241 of query aligns to 6:217/233 of Q92R43
- T49 (= T48) mutation T->F,W: Increases uptake of both methylarsenite and methylarsenate and exhibits higher sensitivity to methylarsenite.
- V177 (≠ A173) mutation to I: Decreases methylarsenite transport activity and results in higher resistance to methylarsenite. Slight decrease in methylarsenate transport activity.; mutation to R: Increases methylarsenite transport activity, leading to lower resistance to methylarsenite. Nearly complete loss of methylarsenate transport activity.
I1CR68 Aquaporin-1 from Rhizopus delemar (strain RA 99-880 / ATCC MYA-4621 / FGSC 9543 / NRRL 43880) (Mucormycosis agent) (Rhizopus arrhizus var. delemar) (see paper)
30% identity, 73% coverage: 6:180/241 of query aligns to 59:261/306 of I1CR68
Sites not aligning to the query:
- 275 H→A: Affects pH sensing; when associated with A-85.
3nkaA Crystal structure of aqpz h174g,t183f (see paper)
31% identity, 60% coverage: 6:150/241 of query aligns to 5:161/230 of 3nkaA
Sites not aligning to the query:
P60844 Aquaporin Z; Bacterial nodulin-like intrinsic protein; Water channel AqpZ from Escherichia coli (strain K12) (see paper)
31% identity, 60% coverage: 6:150/241 of query aligns to 3:159/231 of P60844
- C9 (≠ V12) mutation to S: No effect.
- C20 (≠ I23) mutation to S: Loss of oligomerization; no alteration of water permeability.
Sites not aligning to the query:
- 183 T→C: No effect.
- 189 mutation R->V,S: Loss of function.
Q6Z2T3 Aquaporin NIP2-1; Low silicon protein 1; NOD26-like intrinsic protein 2-1; OsNIP2;1; Silicon influx transporter LSI1 from Oryza sativa subsp. japonica (Rice) (see paper)
30% identity, 76% coverage: 4:186/241 of query aligns to 47:236/298 of Q6Z2T3
- A132 (= A92) mutation to T: In lsi; impairs silicon uptake. Grain discoloration. Reduces grain yield 10-fold.
P37451 Propanediol uptake facilitator PduF from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see paper)
33% identity, 44% coverage: 4:109/241 of query aligns to 5:107/264 of P37451
Sites not aligning to the query:
P08995 Nodulin-26; N-26 from Glycine max (Soybean) (Glycine hispida) (see paper)
35% identity, 40% coverage: 52:148/241 of query aligns to 81:180/271 of P08995
Sites not aligning to the query:
- 262 modified: Phosphoserine; by CPK
2o9eA Crystal structure of aqpz mutant t183c complexed with mercury (see paper)
31% identity, 60% coverage: 6:150/241 of query aligns to 5:161/232 of 2o9eA
Sites not aligning to the query:
O94778 Aquaporin-8; AQP-8 from Homo sapiens (Human) (see 4 papers)
40% identity, 40% coverage: 11:107/241 of query aligns to 41:131/261 of O94778
- F48 (≠ L18) mutation to A: Loss of hydrogen peroxide transport activity under stress condition.
- C53 (≠ S25) modified: Cysteine persulfide; modified: Cysteine sulfenic acid (-SOH); mutation to S: Does not affect hydrogen peroxide transport under stress condition.
- H72 (≠ T48) mutation to A: Does not affect hydrogen peroxide transport activity under stress condition.
Sites not aligning to the query:
- 8 C→S: Does not affect loss of hydrogen peroxide transport after stress.
- 38 C→S: Does not affect loss of hydrogen peroxide transport after stress.
- 173 C→A: Loss of hydrogen peroxide transporter activity.; C→S: Slightly affect hydrogen peroxide transport after stress.
- 208 C→S: Does not affect loss of hydrogen peroxide transport after stress.
- 213 R→A: Does not affect hydrogen peroxide transport activity under stress condition.
- 229 I → M: in a breast cancer sample; somatic mutation
- 247 C→S: Does not affect loss of hydrogen peroxide transport after stress.
B1VB61 Propanediol uptake facilitator PduF from Citrobacter freundii (see paper)
34% identity, 44% coverage: 4:108/241 of query aligns to 5:106/269 of B1VB61
Sites not aligning to the query:
P43286 Aquaporin PIP2-1; Plasma membrane intrinsic protein 2-1; AtPIP2;1; Plasma membrane intrinsic protein 2a; PIP2a from Arabidopsis thaliana (Mouse-ear cress) (see 2 papers)
35% identity, 49% coverage: 6:124/241 of query aligns to 39:157/287 of P43286
Sites not aligning to the query:
- 3 modified: N6,N6-dimethyllysine; partial; K→A: 2-fold decrease in water transport activity.; K→R: No effect.
- 6 E→A: No effect.
- 280 modified: Phosphoserine; S→A: Normal subcellular localization.
- 283 modified: Phosphoserine; S→A: Intracellular reticulation pattern, probably corresponding to the endoplasmic reticulum.; S→D: Normal subcellular localization.
P56402 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Mus musculus (Mouse) (see 2 papers)
32% identity, 68% coverage: 51:213/241 of query aligns to 51:223/271 of P56402
- T126 (≠ P123) mutation to M: Does not cause loss of water channel activity, but impairs trafficking from cytoplasmic vesicles to the cell membrane.
Sites not aligning to the query:
- 256 modified: Phosphoserine; S → L: in cph; loss of a phosphorylation site and loss of trafficking to the apical cell membrane; causes aberrant location at the basolateral cell membrane
4nefA X-ray structure of human aquaporin 2 (see paper)
35% identity, 40% coverage: 51:147/241 of query aligns to 50:151/239 of 4nefA
Q96PS8 Aquaporin-10; AQP-10; Aquaglyceroporin-10; Small intestine aquaporin from Homo sapiens (Human) (see 2 papers)
36% identity, 39% coverage: 4:97/241 of query aligns to 20:111/301 of Q96PS8
- E27 (= E11) mutation to Q: Abolishes permeability to glycerol.
- G73 (≠ F59) mutation to A: Increased permeability to glycerol at acidic pH.; mutation to F: Abolishes permeability to glycerol.
- S77 (= S63) mutation S->A,D: Nearly abolishes permeability to glycerol.
- H80 (= H66) mutation to A: Abolishes permeability to glycerol.
- F85 (≠ V71) mutation to A: Nearly abolishes permeability to glycerol.
- R94 (≠ E80) mutation to A: Abolishes permeability to glycerol.
Sites not aligning to the query:
- 133 modified: carbohydrate, N-linked (GlcNAc...) asparagine; N→Q: Abolishes N-glycosylation.
6f7hC Crystal structure of human aqp10 (see paper)
36% identity, 39% coverage: 4:97/241 of query aligns to 5:96/253 of 6f7hC
Sites not aligning to the query:
P41181 Aquaporin-2; AQP-2; ADH water channel; Aquaporin-CD; AQP-CD; Collecting duct water channel protein; WCH-CD; Water channel protein for renal collecting duct from Homo sapiens (Human) (see 12 papers)
30% identity, 68% coverage: 51:213/241 of query aligns to 51:223/271 of P41181
- G64 (= G64) to R: in NDI2; loss of water channel activity; dbSNP:rs104894326
- G78 (≠ K78) mutation to A: Does not affect interaction with MIAC; when associated with A-79.
- C79 (≠ G79) mutation to A: Does not affect interaction with MIAC; when associated with A-78.
- S148 (≠ A143) mutation to A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; mutation to D: Retained in the endoplasmic reticulum.
- R187 (vs. gap) to C: in NDI2; loss of water channel activity; mutant protein does not fold properly; dbSNP:rs104894328
- A190 (= A187) to T: in NDI2; mutant protein does not fold properly and is not functional; dbSNP:rs104894341
- V194 (= V191) to I: in dbSNP:rs772051028
- S216 (≠ L206) to P: in NDI2; loss of water channel activity; dbSNP:rs104894329
- L217 (= L207) mutation to A: Abolishes interaction with MIAC; when associated with A-221.
- Y221 (≠ A211) mutation to A: Abolishes interaction with MIAC; when associated with A-217.
Sites not aligning to the query:
- 229 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 231 S→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; S→D: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 232 E→A: Reduces interaction with MIAC.
- 244 T→A: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.; T→E: No effect on sorting from the ER to the vesicles, redistribution to apical membrane, or endocytosis.
- 254 R → L: in NDI2; results in the loss of arginine vasopressin-mediated phosphorylation at S-256; R → Q: in NDI2; exerts a dominant-negative effect on wild-type-AQP2 in that it interferes with its trafficking to the apical membrane; is a loss of function instead of a gain of function mutation on dominant nephrogenic diabetes insipidus
- 256 modified: Phosphoserine; by PKA; S→A: Retained in vesicles.; S→D: Expressed in the apical membrane.
- 258 E → K: in NDI2; retained in the Golgi compartment; dbSNP:rs104894332
- 262 P → L: in NDI2; mutant protein folds properly and is functional but is retained in intracellular vesicles; able to assemble into tetramers with wild-type AQP2 that properly localize to the apical membrane; dbSNP:rs104894339; P→A: No effect on expression at the apical cell membrane.
Q9SAI4 Aquaporin NIP6-1; NOD26-like intrinsic protein 6-1; AtNIP6;1 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
29% identity, 46% coverage: 2:112/241 of query aligns to 76:183/305 of Q9SAI4
- A119 (≠ G50) mutation to W: 6-fold increase in water transport activity, but impaired in urea transport.
Sites not aligning to the query:
- 252 V→A: No effect.
P55088 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Mus musculus (Mouse) (see 2 papers)
26% identity, 51% coverage: 55:176/241 of query aligns to 84:219/323 of P55088
- S111 (≠ P82) modified: Phosphoserine; by PKG; mutation to A: Loss of phosphorylation by PKG (in vitro). No effect on location at cell membrane.
Sites not aligning to the query:
- 4 natural variant: G -> R
8ct2D Local refinement of aqp1 tetramer (c1; refinement mask included d1 of protein 4.2 and ankyrin-1 ar1-5) in class 2 of erythrocyte ankyrin-1 complex (see paper)
24% identity, 93% coverage: 6:230/241 of query aligns to 10:247/247 of 8ct2D
P47863 Aquaporin-4; AQP-4; Mercurial-insensitive water channel; MIWC; WCH4 from Rattus norvegicus (Rat) (see 4 papers)
26% identity, 51% coverage: 55:176/241 of query aligns to 84:219/323 of P47863
- S180 (≠ G146) modified: Phosphoserine; by PKC; mutation to A: Decreases internalization from the cell membrane in response to PKC activation.
- H201 (≠ A158) mutation to P: Partial loss of transport activity.
Sites not aligning to the query:
- 13 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-17.
- 17 modified: S-palmitoyl cysteine; C→A: Reduced palmitoylation. Loss of palmitoylation; when associated with A-13.
- 285 modified: Phosphoserine
Query Sequence
>RR42_RS29350 FitnessBrowser__Cup4G11:RR42_RS29350
MIGLPRQIAGEVIGTALLLAVVIGSGIMAERLAGGNVAVALLANTLATVGGLYVLIEVFG
PISGAHFNPAVSMVMAVKGELPRYALAPYIVAQLAGAVLGAWLAHAMFDVSILQLSAKMR
SGPGQWIAEAVATAGLILVILRAPDGRAPAMVASYIGAAYWFTASTSFANPAAAFGRMFS
NSFAGIAPASVPGFVLAELLGACIGLLLHTALLPRVQEQGHPNVIEASGQQEDSPATGGH
I
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory