Comparing RR42_RS29530 FitnessBrowser__Cup4G11:RR42_RS29530 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
5a1sD Crystal structure of the sodium-dependent citrate symporter secits form salmonella enterica. (see paper)
29% identity, 94% coverage: 29:450/451 of query aligns to 3:431/434 of 5a1sD
5x9rA Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
30% identity, 93% coverage: 33:450/451 of query aligns to 1:416/416 of 5x9rA
5xarD Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
28% identity, 94% coverage: 25:450/451 of query aligns to 1:410/411 of 5xarD
5xasB Structural insights into the elevator-like mechanism of the sodium/citrate symporter cits (see paper)
28% identity, 94% coverage: 29:450/451 of query aligns to 2:406/407 of 5xasB
>RR42_RS29530 FitnessBrowser__Cup4G11:RR42_RS29530
MQTTSHTLPPAEAQQTAIKPRFWPEGWWKLMEFRIGIIPLPVYVILLALIAGFAVTGKVP
GEISMAIAVLAFFGFTCAEIGKRLPIIRNIGAAAIFATFIPSALTYYHLLPKPILSLTTE
FTKSTNFLYLFIASIIVGSILSMDRRVLIQGFIKIFIPLAVGSIAAGIVGTAVGTALGLG
AHHTFFYIVVPIMAGGVGEGAIPLSIGYSEILHLPQGDLFAQVLPPVMLGSLTAIILSGV
LDKVGKRFPHLTGEGRLQVGEEDEMDPVQEEIRGHIDVTHIAAAGITAITLYLLGLMCRN
LFGLPAPVAMLFLAVLVKITRAVSPPLQEGAFVVYKFFSTAVTYPLLFAIGVAMTPWDKL
IAAFTLANIVTIVATVTTLMGTGFVVARMLKMHPIDTAIVNACHSGQGGTGDVAILTAAN
RMTLMPFAQIATRIGGAIVVTLTLIVLAHMG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory