SitesBLAST
Comparing RR42_RS31315 FitnessBrowser__Cup4G11:RR42_RS31315 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7vw6B Cryo-em structure of formate dehydrogenase 1 from methylorubrum extorquens am1 (see paper)
58% identity, 97% coverage: 14:566/569 of query aligns to 12:556/560 of 7vw6B
- binding fe2/s2 (inorganic) cluster: C108 (= C114), T112 (≠ A118), C113 (= C119), C141 (= C146), L144 (≠ R149), C145 (= C150)
- binding flavin mononucleotide: G221 (= G226), G223 (= G228), K232 (= K237), N248 (= N253), D250 (= D255), Y324 (= Y334), G327 (= G337), E328 (= E338), N363 (≠ H373), N364 (= N374), T367 (= T377)
- binding iron/sulfur cluster: I325 (= I335), P343 (= P353), S496 (= S506), C497 (= C507), G498 (= G508), Q499 (= Q509), C500 (= C510), C503 (= C513), I536 (= I546), C537 (= C547), L539 (= L549), G540 (= G550)
8a6tB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from thermoanaerobacter kivui in the reduced state (see paper)
39% identity, 66% coverage: 192:567/569 of query aligns to 167:554/630 of 8a6tB
- binding flavin mononucleotide: G201 (= G228), N227 (= N253), E230 (= E256), N355 (= N374), G535 (= G548), L536 (= L549)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: S320 (≠ E339), R337 (= R356), R340 (≠ Y359), T341 (≠ V360), N342 (≠ A361), S433 (= S452)
- binding iron/sulfur cluster: S487 (= S506), C488 (= C507), G489 (= G508), C491 (= C510), C494 (= C513), C534 (= C547), L536 (= L549), G537 (= G550)
- binding zinc ion: C471 (≠ S490)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 36, 82, 85, 86
- binding iron/sulfur cluster: 575, 577, 582, 583, 585, 588, 592, 596, 597, 607, 612, 618, 622, 624, 626, 627
- binding zinc ion: 558, 564
7o6yB Cryo-em structure of respiratory complex i under turnover (see paper)
39% identity, 67% coverage: 190:568/569 of query aligns to 16:419/457 of 7o6yB
- binding flavin mononucleotide: G57 (= G226), G59 (= G228), K68 (= K237), N89 (= N253), D91 (= D255), E92 (= E256), G180 (= G337), E181 (= E338), E182 (= E339), T216 (≠ H373), N217 (= N374)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G59 (= G228), G60 (= G229), F63 (= F232), K68 (= K237), E94 (= E258), Y177 (= Y334), E182 (= E339), F202 (≠ Y359), T324 (≠ S479)
- binding iron/sulfur cluster: P196 (= P353), S351 (= S506), C352 (= C507), G353 (= G508), Q354 (= Q509), C355 (= C510), C358 (= C513), T396 (≠ S545), C398 (= C547), L400 (= L549)
7b0nF 3.7-angstrom structure of Yarrowia lipolytica complex I with an R121M mutation in NUCM. (see paper)
39% identity, 67% coverage: 190:568/569 of query aligns to 17:420/460 of 7b0nF
- binding flavin mononucleotide: G60 (= G228), K69 (= K237), N90 (= N253), D92 (= D255), E93 (= E256), G94 (= G257), Y178 (= Y334), G181 (= G337), E182 (= E338), N218 (= N374)
- binding iron/sulfur cluster: P197 (= P353), S352 (= S506), C353 (= C507), Q355 (= Q509), C356 (= C510), C359 (= C513), T397 (≠ S545), C399 (= C547)
6saqB Wild-type nuoef from aquifex aeolicus bound to nadh-oh (see paper)
37% identity, 70% coverage: 168:567/569 of query aligns to 11:412/419 of 6saqB
- binding flavin mononucleotide: G64 (= G226), G66 (= G228), K75 (= K237), N91 (= N253), D93 (= D255), E94 (= E256), Y179 (= Y334), G182 (= G337), E183 (= E338), N218 (≠ H373), N219 (= N374), T222 (= T377)
- binding [[(2~{R},3~{S},4~{R},5~{R})-5-(6-aminopurin-9-yl)-3,4-bis(oxidanyl)oxolan-2-yl]methoxy-oxidanyl-phosphoryl] [(2~{R},3~{S},4~{R},5~{R})-5-[[(1~{E},3~{Z})-5-azanyl-4-oxidanyl-5-oxidanylidene-penta-1,3-dienyl]-methanoyl-amino]-3,4-bis(oxidanyl)oxolan-2-yl]methyl hydrogen phosphate: G66 (= G228), G67 (= G229), A68 (= A230), F70 (= F232), K75 (= K237), E94 (= E256), E96 (= E258), T99 (= T261), E184 (= E339), Y204 (= Y359), T318 (≠ S479)
- binding iron/sulfur cluster: P198 (= P353), T345 (≠ S506), C346 (= C507), G347 (= G508), Q348 (= Q509), C349 (= C510), C352 (= C513), I391 (= I546), C392 (= C547), G395 (= G550)
6q9cB Crystal structure of aquifex aeolicus nadh-quinone oxidoreductase subunits nuoe and nuof bound to nadh under anaerobic conditions (see paper)
37% identity, 70% coverage: 168:567/569 of query aligns to 11:412/418 of 6q9cB
- binding flavin mononucleotide: G64 (= G226), G66 (= G228), K75 (= K237), N91 (= N253), D93 (= D255), E94 (= E256), G182 (= G337), E183 (= E338), E184 (= E339), V217 (≠ E372), N218 (≠ H373), N219 (= N374), T222 (= T377), G393 (= G548)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G66 (= G228), G67 (= G229), A68 (= A230), F70 (= F232), K75 (= K237), E94 (= E256), E96 (= E258), Y179 (= Y334), E184 (= E339), Y204 (= Y359)
- binding iron/sulfur cluster: P198 (= P353), T345 (≠ S506), C346 (= C507), G347 (= G508), Q348 (= Q509), C349 (= C510), C352 (= C513), I391 (= I546), C392 (= C547), L394 (= L549), G395 (= G550)
7q5yC Structure of nadh:ubichinon oxidoreductase (complex i) of the hyperthermophilic eubacterium aquifex aeolicus
37% identity, 70% coverage: 168:567/569 of query aligns to 12:413/419 of 7q5yC
- binding flavin mononucleotide: G65 (= G226), G67 (= G228), K76 (= K237), N92 (= N253), E95 (= E256), Y180 (= Y334), G183 (= G337), E184 (= E338), V218 (≠ E372), N219 (≠ H373), N220 (= N374), T223 (= T377)
- binding iron/sulfur cluster: T346 (≠ S506), C347 (= C507), G348 (= G508), Q349 (= Q509), C350 (= C510), C353 (= C513), S391 (= S545), I392 (= I546), C393 (= C547), G396 (= G550)
6hl3B Wild-type nuoef from aquifex aeolicus - oxidized form bound to NAD+ (see paper)
37% identity, 70% coverage: 168:567/569 of query aligns to 10:411/416 of 6hl3B
- binding flavin mononucleotide: G63 (= G226), G65 (= G228), K74 (= K237), N90 (= N253), D92 (= D255), E93 (= E256), G181 (= G337), E182 (= E338), E183 (= E339), V216 (≠ E372), N217 (≠ H373), N218 (= N374), T221 (= T377)
- binding nicotinamide-adenine-dinucleotide: G65 (= G228), G66 (= G229), A67 (= A230), F69 (= F232), K74 (= K237), E95 (= E258), Y178 (= Y334), E183 (= E339), K200 (≠ R356), Y203 (= Y359)
- binding iron/sulfur cluster: I179 (= I335), P197 (= P353), T344 (≠ S506), C345 (= C507), G346 (= G508), Q347 (= Q509), C348 (= C510), C351 (= C513), S389 (= S545), I390 (= I546), C391 (= C547), L393 (= L549), G394 (= G550)
7zm7B Cryoem structure of mitochondrial complex i from chaetomium thermophilum (inhibited by ddm) (see paper)
38% identity, 66% coverage: 194:568/569 of query aligns to 29:421/456 of 7zm7B
- binding flavin mononucleotide: G59 (= G226), G61 (= G228), K70 (= K237), N91 (= N253), D93 (= D255), G182 (= G337), E183 (= E338), E184 (= E339), A218 (≠ H373), N219 (= N374), A401 (≠ G548), L402 (= L549)
- binding iron/sulfur cluster: P198 (= P353), C354 (= C507), G355 (= G508), Q356 (= Q509), C357 (= C510), C360 (= C513), T398 (≠ S545), C400 (= C547), L402 (= L549)
7p8nB Tmhydabc- t. Maritima hydrogenase with bridge closed (see paper)
39% identity, 66% coverage: 191:567/569 of query aligns to 151:540/613 of 7p8nB
- binding flavin mononucleotide: G185 (= G226), R186 (≠ L227), G187 (= G228), N213 (= N253), D215 (= D255), E216 (= E256), G217 (= G257), F301 (≠ Y334), G304 (= G337), E305 (= E338), E306 (= E339), N340 (≠ H373), N341 (= N374), G521 (= G548), L522 (= L549)
- binding iron/sulfur cluster: P320 (= P353), S473 (= S506), C474 (= C507), G475 (= G508), K476 (≠ Q509), C477 (= C510), C480 (= C513), L519 (≠ I546), C520 (= C547), L522 (= L549), G523 (= G550)
- binding zinc ion: C457 (≠ S490)
Sites not aligning to the query:
- binding fe2/s2 (inorganic) cluster: 31, 33, 34, 36, 67, 68, 69, 70, 71
- binding iron/sulfur cluster: 560, 567, 570, 571, 573, 577, 590, 592, 597, 599, 600, 601, 603, 607
- binding zinc ion: 544, 549, 554
7q4vB Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
34% identity, 80% coverage: 111:567/569 of query aligns to 8:523/599 of 7q4vB
- binding fe2/s2 (inorganic) cluster: C11 (= C114), C16 (= C119), C48 (= C146), F49 (≠ I147), L51 (≠ R149), C52 (= C150)
- binding flavin mononucleotide: G166 (= G226), G168 (= G228), N196 (= N253), D198 (= D255), F284 (≠ Y334), G287 (= G337), E288 (= E338), E289 (= E339), N324 (= N374)
- binding iron/sulfur cluster: C457 (= C507), G458 (= G508), K459 (≠ Q509), C460 (= C510), C463 (= C513), C503 (= C547), G506 (= G550)
- binding zinc ion: C440 (≠ S490)
Sites not aligning to the query:
- binding iron/sulfur cluster: 544, 551, 552, 553, 554, 555, 556, 557, 561, 562, 574, 581, 583, 584, 585, 586, 587, 591, 593, 595
- binding zinc ion: 527, 533
7aqrF Cryo-em structure of arabidopsis thaliana complex-i (peripheral arm) (see paper)
39% identity, 62% coverage: 212:564/569 of query aligns to 46:415/434 of 7aqrF
- binding flavin mononucleotide: G60 (= G226), R61 (≠ L227), G62 (= G228), K71 (= K237), N89 (= N253), D91 (= D255), Y177 (= Y334), G180 (= G337), E181 (= E338), E182 (= E339), T216 (≠ H373), N217 (= N374)
- binding iron/sulfur cluster: S351 (= S506), C352 (= C507), G353 (= G508), Q354 (= Q509), C355 (= C510), C358 (= C513), T396 (≠ S545), C398 (= C547), L400 (= L549)
7q4vF Electron bifurcating hydrogenase - hydabc from a. Woodii (see paper)
39% identity, 59% coverage: 232:567/569 of query aligns to 43:394/470 of 7q4vF
- binding flavin mononucleotide: N67 (= N253), G158 (= G337), E159 (= E338), E160 (= E339), G375 (= G548)
- binding nicotinamide-adenine-dinucleotide: F43 (= F232), K48 (= K237), R177 (= R356), F180 (≠ Y359), M297 (≠ F476)
- binding iron/sulfur cluster: S327 (= S506), C328 (= C507), G329 (= G508), K330 (≠ Q509), C331 (= C510), C334 (= C513), L373 (≠ I546), C374 (= C547)
- binding zinc ion: C311 (≠ S490)
Sites not aligning to the query:
- binding flavin mononucleotide: 37, 39
- binding nicotinamide-adenine-dinucleotide: 40
- binding iron/sulfur cluster: 415, 417, 422, 424, 425, 426, 427, 428, 432, 433, 437, 445, 452, 454, 455, 456, 457, 458, 462, 463, 467
- binding zinc ion: 398, 404, 409
8a5eB Cryo-em structure of the electron bifurcating fe-fe hydrogenase hydabc complex from acetobacterium woodii in the reduced state (see paper)
39% identity, 59% coverage: 232:567/569 of query aligns to 20:371/447 of 8a5eB
- binding flavin mononucleotide: N44 (= N253), G135 (= G337), E137 (= E339), N171 (≠ H373), N172 (= N374), G352 (= G548)
- binding 1,4-dihydronicotinamide adenine dinucleotide: F20 (= F232), K25 (= K237), F28 (≠ I240), D49 (≠ E258), R154 (= R356), F157 (≠ Y359), S250 (= S452)
- binding iron/sulfur cluster: P151 (= P353), C305 (= C507), G306 (= G508), K307 (≠ Q509), C308 (= C510), C311 (= C513), C351 (= C547), G354 (= G550)
- binding zinc ion: C288 (≠ S490)
Sites not aligning to the query:
- binding flavin mononucleotide: 14, 16
- binding 1,4-dihydronicotinamide adenine dinucleotide: 16, 17
- binding iron/sulfur cluster: 392, 399, 401, 402, 403, 405, 409, 410, 414, 429, 431, 432, 433, 435, 439, 440, 444
- binding zinc ion: 375, 381, 386
8b9zF Drosophila melanogaster complex i in the active state (dm1) (see paper)
38% identity, 67% coverage: 189:568/569 of query aligns to 29:428/441 of 8b9zF
- binding flavin mononucleotide: G69 (= G226), G71 (= G228), K80 (= K237), N98 (= N253), D100 (= D255), G189 (= G337), E191 (= E339), N226 (= N374), A408 (≠ G548), L409 (= L549)
- binding iron/sulfur cluster: P205 (= P353), C361 (= C507), G362 (= G508), Q363 (= Q509), C364 (= C510), C367 (= C513), T405 (≠ S545), C407 (= C547), L409 (= L549)
Q56222 NADH-quinone oxidoreductase subunit 1; NADH dehydrogenase I chain 1; NDH-1 subunit 1; EC 7.1.1.- from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
38% identity, 68% coverage: 181:567/569 of query aligns to 20:420/438 of Q56222
8eswV1 NADH dehydrogenase (Ubiquinone) 24 kDa subunit, isoform A (see paper)
38% identity, 67% coverage: 189:568/569 of query aligns to 27:426/439 of 8eswV1
- binding flavin mononucleotide: G67 (= G226), G69 (= G228), K78 (= K237), N96 (= N253), D98 (= D255), E99 (= E256), G187 (= G337), E188 (= E338), N224 (= N374), A406 (≠ G548)
- binding iron/sulfur cluster: I185 (= I335), P203 (= P353), C359 (= C507), Q361 (= Q509), C362 (= C510), C365 (= C513), T403 (≠ S545), I404 (= I546), C405 (= C547), L407 (= L549)
- binding : Y143 (≠ A300), N144 (≠ G301), Q150 (≠ G307), D174 (≠ Q324)
4hea1 Crystal structure of the entire respiratory complex i from thermus thermophilus (see paper)
38% identity, 68% coverage: 181:567/569 of query aligns to 19:419/437 of 4hea1
- binding flavin mononucleotide: G63 (= G226), K74 (= K237), N91 (= N253), D93 (= D255), Y179 (= Y334), G182 (= G337), E183 (= E338), N218 (≠ H373), N219 (= N374), L401 (= L549)
- binding iron/sulfur cluster: I180 (= I335), P198 (= P353), S351 (= S506), C352 (= C507), G353 (= G508), K354 (≠ Q509), C355 (= C510), C358 (= C513), F398 (≠ I546), C399 (= C547), L401 (= L549)
2ybb1 Fitted model for bovine mitochondrial supercomplex i1iii2iv1 by single particle cryo-em (emd-1876) (see paper)
38% identity, 68% coverage: 181:567/569 of query aligns to 19:419/437 of 2ybb1
- binding flavin mononucleotide: G63 (= G226), G65 (= G228), N91 (= N253), D93 (= D255), G182 (= G337), E183 (= E338), E184 (= E339), N218 (≠ H373), N219 (= N374), T222 (= T377), P400 (≠ G548)
- binding 1,4-dihydronicotinamide adenine dinucleotide: G65 (= G228), G66 (= G229), F69 (= F232), K74 (= K237), F77 (≠ I240), E96 (= E258), Y179 (= Y334), E184 (= E339), K201 (≠ R356), F204 (≠ Y359), T324 (≠ S479)
- binding iron/sulfur cluster: S351 (= S506), C352 (= C507), K354 (≠ Q509), C355 (= C510), C358 (= C513), F398 (≠ I546), C399 (= C547), L401 (= L549), A402 (≠ G550)
8oh5B Cryo-em structure of the electron bifurcating transhydrogenase stnabc complex from sporomusa ovata (state 2) (see paper)
34% identity, 81% coverage: 109:567/569 of query aligns to 1:508/584 of 8oh5B
- binding fe2/s2 (inorganic) cluster: C10 (≠ A118), C41 (= C146), C45 (= C150)
- binding flavin mononucleotide: R154 (≠ L227), K164 (= K237), N181 (= N253), F269 (≠ Y334), E273 (= E338), E274 (= E339), I307 (≠ E372), N308 (≠ H373), N309 (= N374), G489 (= G548), L490 (= L549)
- binding nicotinamide-adenine-dinucleotide: G155 (= G228), G156 (= G229), F159 (= F232), F163 (≠ R236), E273 (= E338), E274 (= E339), K291 (≠ R356), F294 (≠ Y359), G413 (= G478)
- binding iron/sulfur cluster: P288 (= P353), C442 (= C507), G443 (= G508), C445 (= C510), C448 (= C513), C488 (= C547), L490 (= L549), G491 (= G550)
- binding zinc ion: C425 (≠ S490)
Sites not aligning to the query:
- binding iron/sulfur cluster: 531, 536, 540, 542, 546, 547, 548, 559, 566, 567, 568, 569, 572
- binding zinc ion: 512, 518, 523
Query Sequence
>RR42_RS31315 FitnessBrowser__Cup4G11:RR42_RS31315
MNQVVIPIAVQDIGKARKRRQPKGRQPDPAALAEVQAALGDAPRRRDLLIEHLHAINDRF
GQLAIPHLVALAQEMGLSMAEVYEVATFYHHFDVVREDGDGVIRPPAAVTVRVCEGIACE
LGGGRDLLARLPALLGSEVKVVAAPCIGRCERAPAALVGQNPVDFASAQTIADTVAARAV
HHAPEAHLGYDDYRAQGGYQLLRAVASGEHDSESLLRTMEDSGLRGLGGAGFPTGRKWRI
VMAEPAPRLMAVNLDEGEPGTFKDRVYLERDPHRFLEGMLIAAAVTQVSAIYIYLRDEYA
GCRAVLGQALRRLQAEPPIPDMPQIQLRRGAGAYICGEESAMIESIEGKRGMPRLRPPYV
AQVGLFGRPTLEHNFETLYWVREILEKGAGWFAAQGRHGRHGLRSFSVSGRVKLPGVHVA
PAGITVSELIEEYCGGMQDGHCFYGYLPGGASGGILPASLGDIPLDFDTLQPYGCFIGSA
AIVVFSEQDSAVAVARNLMHFFKHESCGQCTPCRVGTAKALDVIAQPKWDLAALADLSAV
MRDASICGLGQAAPNPVDCVIKYFPQELA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory