SitesBLAST
Comparing RR42_RS31730 FitnessBrowser__Cup4G11:RR42_RS31730 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4mynA Crystal structure of trypanosoma cruzi formiminoglutamase n114h variant with mn2+2 (see paper)
33% identity, 87% coverage: 42:312/313 of query aligns to 21:291/298 of 4mynA
- active site: H110 (= H124), D134 (= D153), H136 (= H155), D138 (= D157), S150 (= S166), D224 (= D244), D226 (= D246), E269 (= E289)
- binding manganese (ii) ion: H110 (= H124), D134 (= D153), D134 (= D153), H136 (= H155), D138 (= D157), D224 (= D244), D224 (= D244), D226 (= D246)
5cevA Arginase from bacillus caldevelox, l-lysine complex (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 5:293/298 of 5cevA
- active site: H98 (= H124), D121 (= D153), H123 (= H155), D125 (= D157), H138 (vs. gap), D225 (= D244), D227 (= D246), E270 (= E289)
- binding guanidine: H251 (≠ E270), E255 (≠ G274)
- binding lysine: S134 (= S166), H138 (vs. gap), E270 (= E289)
- binding manganese (ii) ion: H98 (= H124), D121 (= D153), D121 (= D153), H123 (= H155), D125 (= D157), D225 (= D244), D225 (= D244), D227 (= D246)
4cevA Arginase from bacillus caldevelox, l-ornithine complex (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 5:293/298 of 4cevA
- active site: H98 (= H124), D121 (= D153), H123 (= H155), D125 (= D157), H138 (vs. gap), D225 (= D244), D227 (= D246), E270 (= E289)
- binding guanidine: H251 (≠ E270), E255 (≠ G274)
- binding manganese (ii) ion: H98 (= H124), D121 (= D153), D121 (= D153), H123 (= H155), D125 (= D157), D225 (= D244), D225 (= D244), D227 (= D246)
- binding L-ornithine: H123 (= H155), D125 (= D157), S134 (= S166), H138 (vs. gap), D177 (≠ A195)
3cevA Arginase from bacillus caldevelox, complexed with l-arginine (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 5:293/298 of 3cevA
- active site: H98 (= H124), D121 (= D153), H123 (= H155), D125 (= D157), H138 (vs. gap), D225 (= D244), D227 (= D246), E270 (= E289)
- binding arginine: H123 (= H155), D125 (= D157), S134 (= S166), H138 (vs. gap), D225 (= D244), H251 (≠ E270), E255 (≠ G274), E270 (= E289)
- binding manganese (ii) ion: H98 (= H124), D121 (= D153), D125 (= D157), D225 (= D244)
Sites not aligning to the query:
2cevB Arginase from bacillus caldevelox, native structure at ph 8.5 (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 5:293/298 of 2cevB
- active site: H98 (= H124), D121 (= D153), H123 (= H155), D125 (= D157), H138 (vs. gap), D225 (= D244), D227 (= D246), E270 (= E289)
- binding guanidine: H251 (≠ E270), E255 (≠ G274)
- binding manganese (ii) ion: H98 (= H124), D121 (= D153), D121 (= D153), H123 (= H155), D125 (= D157), D225 (= D244), D225 (= D244), D227 (= D246)
1cevA Arginase from bacillus caldovelox, native structure at ph 5.6 (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 6:294/299 of 1cevA
- active site: H99 (= H124), D122 (= D153), H124 (= H155), D126 (= D157), H139 (vs. gap), D226 (= D244), D228 (= D246), E271 (= E289)
- binding manganese (ii) ion: H99 (= H124), D122 (= D153), D122 (= D153), H124 (= H155), D126 (= D157), D226 (= D244), D226 (= D244), D228 (= D246)
P53608 Arginase; EC 3.5.3.1 from Bacillus caldovelox (see paper)
27% identity, 86% coverage: 43:312/313 of query aligns to 6:294/299 of P53608
6dktE Crystal structure of arginase from bacillus subtilis
26% identity, 86% coverage: 43:312/313 of query aligns to 5:263/268 of 6dktE
3pzlB The crystal structure of agmatine ureohydrolase of thermoplasma volcanium
26% identity, 82% coverage: 58:313/313 of query aligns to 39:283/293 of 3pzlB
- active site: H112 (= H124), D132 (= D153), H134 (= H155), D136 (= D157), H148 (≠ Q172), D217 (= D244), D219 (= D246), E260 (= E289)
- binding manganese (ii) ion: H112 (= H124), D132 (= D153), D132 (= D153), H134 (= H155), D136 (= D157), D217 (= D244), D217 (= D244), D219 (= D246)
6dktA Crystal structure of arginase from bacillus subtilis
26% identity, 86% coverage: 43:312/313 of query aligns to 5:278/283 of 6dktA
6nfpD 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
25% identity, 86% coverage: 43:312/313 of query aligns to 8:284/289 of 6nfpD
6nfpA 1.7 angstrom resolution crystal structure of arginase from bacillus subtilis subsp. Subtilis str. 168
25% identity, 86% coverage: 43:312/313 of query aligns to 5:287/292 of 6nfpA
1wogA Crystal structure of agmatinase reveals structural conservation and inhibition mechanism of the ureohydrolase superfamily (see paper)
29% identity, 81% coverage: 58:312/313 of query aligns to 43:295/303 of 1wogA
- active site: H119 (= H124), D141 (= D153), H143 (= H155), D145 (= D157), N157 (≠ S166), D227 (= D244), D229 (= D246), E272 (= E289)
- binding hexane-1,6-diamine: H143 (= H155), D145 (= D157), N157 (≠ S166), S158 (≠ G167)
- binding manganese (ii) ion: H119 (= H124), D141 (= D153), D141 (= D153), H143 (= H155), D145 (= D157), D227 (= D244), D227 (= D244), D229 (= D246)
Q9I6K2 Guanidinopropionase; EC 3.5.3.17 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see paper)
28% identity, 86% coverage: 43:312/313 of query aligns to 39:307/318 of Q9I6K2
- H126 (= H124) binding
- D148 (= D153) binding
- H150 (= H155) binding
- D152 (= D157) binding
- Y157 (vs. gap) mutation to M: Reduces substrate affinity 10-fold and catalytic efficiency 3-fold.
- D240 (= D244) binding
- D242 (= D246) binding
3nipB Crystal structure of pseudomonas aeruginosa guanidinopropionase complexed with 1,6-diaminohexane (see paper)
28% identity, 86% coverage: 43:312/313 of query aligns to 37:305/316 of 3nipB
- active site: H124 (= H124), D146 (= D153), H148 (= H155), D150 (= D157), H163 (≠ S166), D238 (= D244), D240 (= D246), E282 (= E289)
- binding hexane-1,6-diamine: R49 (= R58), P244 (≠ A250), F246 (≠ V252), P248 (= P254), A292 (≠ Q299), V296 (= V303)
3niqA Crystal structure of pseudomonas aeruginosa guanidinopropionase (see paper)
28% identity, 86% coverage: 43:312/313 of query aligns to 36:304/315 of 3niqA
- active site: H123 (= H124), D145 (= D153), H147 (= H155), D149 (= D157), H162 (≠ S166), D237 (= D244), D239 (= D246), E281 (= E289)
- binding manganese (ii) ion: H123 (= H124), D145 (= D153), D145 (= D153), H147 (= H155), D149 (= D157), D237 (= D244), D237 (= D244), D239 (= D246)
1t4tA Arginase-dinor-noha complex (see paper)
24% identity, 85% coverage: 29:293/313 of query aligns to 3:276/314 of 1t4tA
- active site: H96 (= H124), D119 (= D153), H121 (= H155), D123 (= D157), H136 (≠ F170), D227 (= D244), D229 (= D246), E272 (= E289)
- binding 3-{[(e)-amino(hydroxyimino)methyl]amino}alanine: H121 (= H155), D123 (= D157), N125 (≠ R159), D178 (vs. gap), T241 (≠ A258)
- binding manganese (ii) ion: H96 (= H124), D119 (= D153), D119 (= D153), H121 (= H155), D123 (= D157), D227 (= D244), D227 (= D244), D229 (= D246)
2ef5A Crystal structure of the arginase from thermus thermophilus
30% identity, 86% coverage: 43:312/313 of query aligns to 5:268/273 of 2ef5A
- active site: H80 (= H124), D102 (= D153), H104 (= H155), D106 (= D157), H118 (vs. gap), D200 (= D244), D202 (= D246), E245 (= E289)
- binding lysine: P9 (≠ A47), D15 (≠ A62), M16 (≠ Q63), S19 (≠ D66)
- binding manganese (ii) ion: H80 (= H124), D102 (= D153), D102 (= D153), H104 (= H155), D106 (= D157), D200 (= D244), D200 (= D244), D202 (= D246)
3m1rD The crystal structure of formimidoylglutamase from bacillus subtilis subsp. Subtilis str. 168
21% identity, 80% coverage: 57:307/313 of query aligns to 53:308/321 of 3m1rD
- active site: N130 (≠ H124), D153 (= D153), H155 (= H155), D157 (= D157), N168 (≠ S166), D245 (= D244), D247 (= D246), E290 (= E289)
- binding calcium ion: N130 (≠ H124), D153 (= D153), D153 (= D153), H155 (= H155), H155 (= H155), D157 (= D157), D245 (= D244), D245 (= D244), D247 (= D246)
4q41A Crystal structure of schistosoma mansoni arginase in complex with l- lysine (see paper)
28% identity, 76% coverage: 54:292/313 of query aligns to 16:282/333 of 4q41A
- active site: H103 (= H124), D126 (= D153), H128 (= H155), D130 (= D157), H143 (vs. gap), D234 (= D244), D236 (= D246), E279 (= E289)
- binding lysine: N132 (≠ R159), H143 (vs. gap), D185 (≠ R203)
- binding manganese (ii) ion: H103 (= H124), D126 (= D153), D126 (= D153), H128 (= H155), D130 (= D157), D234 (= D244), D234 (= D244), D236 (= D246)
Query Sequence
>RR42_RS31730 FitnessBrowser__Cup4G11:RR42_RS31730
MSMAMTESVWQGRSDAGERGDTRRLFHVVRAAGAPLPAGSPVVVGFACDAGVLRNHGRAG
AAQGPDAIRRALANVPAHGLPALYDAGNVICEDDALEAAQERLAGAVRAVLDGGGLPLVL
GGGHEVAWGSWQGLRAHLDAAGDGGRLLIVNIDAHFDLRTSRPASSGTPFDQIACESARR
GLPFDYVCLGVSRLANTPALFARADELGVSYVEDVDLQERHLDARLAALRERMALAEHVY
LTIDLDALPAAVMPGVSAPAAFGVPLAVVEALVGEVRRSGKLRVADLAEYNPSYDRDHQG
ARVAARLAYRLLA
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory