SitesBLAST
Comparing RR42_RS31980 FitnessBrowser__Cup4G11:RR42_RS31980 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3ozwA The crystal structure of flavohemoglobin from r. Eutrophus in complex with ketoconazole (see paper)
34% identity, 63% coverage: 17:233/342 of query aligns to 165:397/403 of 3ozwA
- binding flavin-adenine dinucleotide: R206 (= R57), Q207 (≠ C58), Y208 (= Y59), S209 (= S60), S222 (≠ T74), V223 (≠ I75), K224 (= K76), E226 (≠ V78), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R82), V236 (= V83), S237 (= S84), V276 (≠ S122), T279 (= T125), V395 (≠ R231), F396 (= F232)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 50
- binding protoporphyrin ix containing fe: 42, 43, 81, 85, 88, 90, 94, 95, 98, 126, 130, 133
- binding 1-acetyl-4-(4-{[(2R,4S)-2-(2,4-dichlorophenyl)-2-(1H-imidazol-1-ylmethyl)-1,3-dioxolan-4-yl]methoxy}phenyl)piperazine: 53, 56, 102, 398
3ozvA The crystal structure of flavohemoglobin from r. Eutrophus in complex with econazole (see paper)
34% identity, 63% coverage: 17:233/342 of query aligns to 165:397/403 of 3ozvA
- binding flavin-adenine dinucleotide: R206 (= R57), Q207 (≠ C58), Y208 (= Y59), S209 (= S60), S222 (≠ T74), V223 (≠ I75), K224 (= K76), E226 (≠ V78), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R82), V236 (= V83), S237 (= S84), V276 (≠ S122), T279 (= T125), F396 (= F232)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 24, 28, 57, 102, 106
- binding flavin-adenine dinucleotide: 44, 46, 48
- binding protoporphyrin ix containing fe: 43, 81, 84, 85, 88, 90, 94, 95, 98, 126, 130, 133
3ozuA The crystal structure of flavohemoglobin from r. Eutrophus in complex with miconazole (see paper)
34% identity, 63% coverage: 17:233/342 of query aligns to 165:397/403 of 3ozuA
- binding flavin-adenine dinucleotide: R206 (= R57), Q207 (≠ C58), Y208 (= Y59), S209 (= S60), S222 (≠ T74), V223 (≠ I75), K224 (= K76), E226 (≠ V78), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R82), V236 (= V83), S237 (= S84), E394 (= E230), V395 (≠ R231), G397 (= G233)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
- binding 1-[(2R)-2-[(2,4-dichlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1H-imidazole: 25, 28, 43, 56, 57, 102, 122, 125, 126
P39662 Flavohemoprotein; FHP; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Cupriavidus necator (strain ATCC 17699 / DSM 428 / KCTC 22496 / NCIMB 10442 / H16 / Stanier 337) (Ralstonia eutropha) (see paper)
34% identity, 63% coverage: 17:233/342 of query aligns to 165:397/403 of P39662
Sites not aligning to the query:
- 60 A→Y: Does not affect phospholipid-binding.
- 98 V→F: Blocks phospholipid-binding.
1cqxA Crystal structure of the flavohemoglobin from alcaligenes eutrophus at 1.75 a resolution (see paper)
34% identity, 63% coverage: 17:233/342 of query aligns to 165:397/403 of 1cqxA
- binding flavin-adenine dinucleotide: Y190 (≠ F43), R206 (= R57), Q207 (≠ C58), Y208 (= Y59), S209 (= S60), S222 (≠ T74), E226 (≠ V78), Q231 (vs. gap), P232 (vs. gap), G234 (vs. gap), Y235 (≠ R82), V236 (= V83), S237 (= S84), V395 (≠ R231), G397 (= G233)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 47, 398
- binding protoporphyrin ix containing fe: 43, 44, 81, 85, 88, 90, 94, 95, 98, 126, 129, 130, 133
2piaA Phthalate dioxygenase reductase: a modular structure for electron transfer from pyridine nucleotides to [2fe-2s] (see paper)
30% identity, 88% coverage: 38:338/342 of query aligns to 39:319/321 of 2piaA
- binding fe2/s2 (inorganic) cluster: S270 (≠ N287), C272 (= C289), E273 (≠ R290), G275 (= G292), C277 (= C294), G278 (= G295), C280 (= C297), C308 (= C327)
- binding flavin mononucleotide: N44 (≠ F43), R55 (= R57), T56 (≠ C58), Y57 (= Y59), S58 (= S60), A72 (≠ T74), V73 (≠ I75), G79 (vs. gap), R80 (= R79), G82 (= G81), S83 (≠ R82), I121 (≠ S122), T124 (= T125), E223 (= E230), F225 (= F232)
P33164 Phthalate dioxygenase reductase; PDR; EC 1.-.-.- from Burkholderia cepacia (Pseudomonas cepacia) (see paper)
30% identity, 88% coverage: 38:338/342 of query aligns to 40:320/322 of P33164
6laaA Crystal structure of full-length cyp116b46 from tepidiphilus thermophilus (see paper)
28% identity, 84% coverage: 55:340/342 of query aligns to 485:753/753 of 6laaA
- binding fe2/s2 (inorganic) cluster: S700 (≠ N287), C702 (= C289), E703 (≠ R290), G705 (= G292), C707 (= C294), G708 (= G295), C710 (= C297), C740 (= C327)
- binding flavin mononucleotide: R487 (= R57), Q488 (≠ C58), Y489 (= Y59), S490 (= S60), Q506 (≠ K76), S511 (≠ V78), R512 (= R79), G514 (= G81), S515 (= S84), I553 (≠ S122), E651 (= E230), F653 (= F232)
Sites not aligning to the query:
- active site: 177, 251, 252, 359, 360, 361
- binding carbonate ion: 90, 91, 92, 241
- binding protoporphyrin ix containing fe: 54, 91, 92, 99, 103, 249, 252, 253, 298, 351, 352, 353, 357, 359, 361
6kbhA Crystal structure of an intact type iv self-sufficient cytochrome p450 monooxygenase
30% identity, 86% coverage: 48:340/342 of query aligns to 490:765/765 of 6kbhA
- binding fe2/s2 (inorganic) cluster: C714 (= C289), E715 (≠ R290), G717 (= G292), C719 (= C294), G720 (= G295), C722 (= C297), C752 (= C327)
- binding flavin mononucleotide: R499 (= R57), Q500 (≠ C58), Y501 (= Y59), S502 (= S60), A516 (≠ T74), L518 (vs. gap), S523 (≠ V78), R524 (= R79), G526 (= G81), S527 (= S84), I565 (≠ S122), T568 (= T125), E663 (= E230), F665 (= F232), I718 (≠ L293)
Sites not aligning to the query:
- active site: 190, 264, 265, 372, 373, 374
- binding protoporphyrin ix containing fe: 67, 104, 105, 112, 116, 261, 262, 265, 266, 308, 311, 313, 364, 365, 370, 372, 373, 374, 378
7ylrA Structure of a bacteria protein
29% identity, 88% coverage: 38:338/342 of query aligns to 36:325/326 of 7ylrA
- binding fe2/s2 (inorganic) cluster: C276 (= C289), K277 (≠ R290), G279 (= G292), C281 (= C294), G282 (= G295), C284 (= C297), C314 (= C327)
- binding flavin mononucleotide: R56 (= R57), H57 (≠ C58), Y58 (= Y59), S59 (= S60), A79 (vs. gap), V80 (vs. gap), R81 (vs. gap), G86 (vs. gap), R87 (= R79), G89 (= G81), S90 (= S84), T131 (= T125), E229 (= E230), F231 (= F232), E233 (≠ T246), R278 (≠ S291)
P0DPQ8 Aromatic O-demethylase, reductase subunit; NADH--hemoprotein reductase; EC 1.6.2.- from Amycolatopsis sp. (strain ATCC 39116 / 75iv2) (see paper)
31% identity, 66% coverage: 7:232/342 of query aligns to 96:330/334 of P0DPQ8
Sites not aligning to the query:
- 35 binding
- 40 binding
- 43 binding
- 75 binding
- 334 binding
5ogxA Crystal structure of amycolatopsis cytochrome p450 reductase gcob. (see paper)
31% identity, 66% coverage: 7:232/342 of query aligns to 95:329/333 of 5ogxA
- binding flavin-adenine dinucleotide: Y132 (≠ F43), R144 (≠ Q55), Q145 (= Q56), Y146 (= Y59), S147 (= S60), H161 (≠ T74), V162 (≠ I75), V165 (= V78), G168 (= G81), V169 (≠ R82), A170 (≠ V83), T171 (≠ S84), T214 (≠ S122), F329 (= F232)
Sites not aligning to the query:
4eh1A Crystal structure of the flavohem-like-fad/NAD binding domain of nitric oxide dioxygenase from vibrio cholerae o1 biovar el tor
30% identity, 57% coverage: 38:233/342 of query aligns to 34:236/237 of 4eh1A
- binding flavin-adenine dinucleotide: Y39 (≠ F43), R55 (= R57), Q56 (≠ C58), Y57 (= Y59), S58 (= S60), S71 (≠ T74), V72 (≠ I75), E75 (≠ V78), N81 (≠ R79), G83 (= G81), L84 (≠ R82), V85 (= V83), S86 (= S84), T127 (= T125), E233 (= E230), F235 (= F232)
Q03331 Flavohemoprotein; Flavohemoglobin; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Candida norvegensis (Yeast) (Candida mycoderma) (see paper)
26% identity, 68% coverage: 5:237/342 of query aligns to 159:388/390 of Q03331
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 2 modified: N-acetylserine
1gvhA The x-ray structure of ferric escherichia coli flavohemoglobin reveals an unespected geometry of the distal heme pocket (see paper)
31% identity, 57% coverage: 38:233/342 of query aligns to 183:391/396 of 1gvhA
- binding flavin-adenine dinucleotide: Y188 (≠ F43), R204 (= R57), Q205 (≠ C58), Y206 (= Y59), S207 (= S60), A220 (≠ T74), V221 (≠ I75), E224 (≠ V78), G227 (= G81), Q228 (≠ R82), V229 (= V83), S230 (= S84), V269 (≠ S122), T272 (= T125), E388 (= E230), F390 (= F232)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 46, 48, 50
- binding protoporphyrin ix containing fe: 43, 53, 56, 57, 60, 61, 81, 84, 85, 90, 94, 95, 127, 131, 393
P24232 Flavohemoprotein; Flavohemoglobin; HMP; Hemoglobin-like protein; Nitric oxide dioxygenase; NO oxygenase; NOD; EC 1.14.12.17 from Escherichia coli (strain K12) (see 2 papers)
31% identity, 57% coverage: 38:233/342 of query aligns to 183:391/396 of P24232
Sites not aligning to the query:
- 29 mutation Y->E,H: 15 to 35-fold reduction in NO dioxygenase activity.; Y→F: 30-fold reduction in NO dioxygenase activity, and 80-fold increase in the O(2) dissociation rate constant.
- 95 active site, Charge relay system
- 135 active site, Charge relay system
2eixA The structure of physarum polycephalum cytochrome b5 reductase (see paper)
28% identity, 54% coverage: 41:226/342 of query aligns to 45:239/243 of 2eixA
- active site: H47 (≠ F43), Y63 (= Y59), T64 (≠ S60), C217 (= C204)
- binding flavin-adenine dinucleotide: R61 (= R57), P62 (≠ C58), Y63 (= Y59), T64 (≠ S60), I78 (≠ T74), Y82 (≠ V78), K84 (≠ G80), G85 (= G81), M87 (≠ V83), S88 (= S84), T126 (≠ S122), T129 (= T125), F195 (≠ G182), M221 (≠ F209), A225 (= A213)
1krhA X-ray structure of benzoate dioxygenase reductase (see paper)
26% identity, 65% coverage: 11:234/342 of query aligns to 112:336/337 of 1krhA
- active site: C306 (= C204)
- binding flavin-adenine dinucleotide: Y143 (≠ F43), R155 (= R57), S156 (≠ C58), Y157 (= Y59), S158 (= S60), V171 (≠ T74), V172 (≠ I75), G178 (= G81), K179 (≠ R82), M180 (≠ V83), S181 (= S84), T219 (≠ S122), E332 (= E230), F334 (= F232), S335 (≠ G233), A336 (= A234)
Sites not aligning to the query:
1tvcA Fad and nadh binding domain of methane monooxygenase reductase from methylococcus capsulatus (bath) (see paper)
27% identity, 57% coverage: 38:232/342 of query aligns to 44:244/250 of 1tvcA
- active site: Y63 (= Y59), S64 (= S60), L215 (≠ I203)
- binding dihydroflavine-adenine dinucleotide: F49 (= F43), R61 (= R57), S62 (≠ C58), Y63 (= Y59), S64 (= S60), L78 (≠ T74), I79 (= I75), R80 (≠ K76), L82 (≠ V78), F87 (≠ V83), G128 (= G123), N155 (≠ D150), E159 (≠ S153), S186 (vs. gap), G187 (vs. gap), E242 (= E230), F244 (= F232)
Sites not aligning to the query:
4g1bA X-ray structure of yeast flavohemoglobin in complex with econazole (see paper)
28% identity, 57% coverage: 40:233/342 of query aligns to 186:391/398 of 4g1bA
- binding flavin-adenine dinucleotide: Y189 (≠ F43), R207 (= R57), H208 (≠ C58), Y209 (= Y59), S210 (= S60), A223 (≠ T74), K225 (= K76), E227 (vs. gap), F233 (≠ V78), P234 (≠ R79), G236 (= G81), L237 (≠ R82), V238 (= V83), S239 (= S84), V282 (≠ S122), F390 (= F232)
Sites not aligning to the query:
- binding 1-[(2s)-2-[(4-chlorobenzyl)oxy]-2-(2,4-dichlorophenyl)ethyl]-1h-imidazole: 28, 29, 56, 57, 60, 102, 126
- binding flavin-adenine dinucleotide: 46, 50, 84
- binding protoporphyrin ix containing fe: 42, 43, 44, 47, 60, 80, 81, 84, 85, 88, 90, 94, 95, 98, 133, 392, 393, 394
Query Sequence
>RR42_RS31980 FitnessBrowser__Cup4G11:RR42_RS31980
MVQAQFHPLRIAQVVAETDEASSLVFELPDGLRDTFAYRPGQFLTLKVPLEGAAQQRCYS
LSSSPQVDSALRVTIKRVRGGRVSNWICDRLGAGDTVEVMPPAGVFTPRSLDGDLLLFAG
GSGITPVLSIAKAALRHGGGNVTLIYANRDERSVIFRDALCELAARHADRLRVIHWLDSV
QGPPSQAQLEALAAPWGHADCFICGPGPFMDGAQAALQTLGVARERIHVERFGAPPPAAV
PAKEQTPAACAPAALEVELDGVRHRLDAHAGETVLDAMLRAGVAAPNSCRSGLCGACMCQ
VTHGEATLGENHVLDAADREAGWTLACQARAAGSELHLKFPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory