Comparing RR42_RS32055 FitnessBrowser__Cup4G11:RR42_RS32055 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
A0A0K2JL82 Nitrosuccinate lyase; EC 4.3.99.5 from Streptomyces cremeus (see paper)
45% identity, 98% coverage: 9:442/442 of query aligns to 34:472/476 of A0A0K2JL82
5xnzA Crystal structure of cred complex with fumarate (see paper)
44% identity, 98% coverage: 9:439/442 of query aligns to 20:438/439 of 5xnzA
Q9X0I0 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 94% coverage: 11:426/442 of query aligns to 14:417/431 of Q9X0I0
2x75A Staphylococcus aureus adenylosuccinate lyase (see paper)
28% identity, 82% coverage: 77:438/442 of query aligns to 72:421/427 of 2x75A
Sites not aligning to the query:
P12047 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; Glutamyl--tRNA ligase regulatory factor; EC 4.3.2.2 from Bacillus subtilis (strain 168) (see paper)
29% identity, 81% coverage: 9:367/442 of query aligns to 12:361/431 of P12047
4eeiB Crystal structure of adenylosuccinate lyase from francisella tularensis complexed with amp and succinate
26% identity, 58% coverage: 86:342/442 of query aligns to 82:324/423 of 4eeiB
Sites not aligning to the query:
5hw2A Crystal structure of adenylosuccinate lyase from francisella tularensis complexed with fumaric acid
26% identity, 58% coverage: 86:342/442 of query aligns to 82:324/419 of 5hw2A
Sites not aligning to the query:
Q05911 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see paper)
25% identity, 79% coverage: 88:438/442 of query aligns to 99:458/482 of Q05911
4efcA Crystal structure of adenylosuccinate lyase from trypanosoma brucei, tb427tmp.160.5560
31% identity, 44% coverage: 86:278/442 of query aligns to 115:309/452 of 4efcA
Sites not aligning to the query:
5vkwB Crystal structure of adenylosuccinate lyase ade13 from candida albicans
26% identity, 78% coverage: 88:430/442 of query aligns to 99:443/469 of 5vkwB
Sites not aligning to the query:
5eytA Crystal structure of adenylosuccinate lyase from schistosoma mansoni in complex with amp (see paper)
24% identity, 80% coverage: 87:438/442 of query aligns to 93:449/472 of 5eytA
Sites not aligning to the query:
P0AB89 Adenylosuccinate lyase; ASL; Adenylosuccinase; ASase; EC 4.3.2.2 from Escherichia coli (strain K12) (see 2 papers)
28% identity, 43% coverage: 89:278/442 of query aligns to 114:305/456 of P0AB89
Sites not aligning to the query:
3gzhA Crystal structure of phosphate-bound adenylosuccinate lyase from e. Coli (see paper)
28% identity, 43% coverage: 89:278/442 of query aligns to 127:318/469 of 3gzhA
Sites not aligning to the query:
2ptqA Crystal structure of escherichia coli adenylosuccinate lyase mutant h171n with bound amp and fumarate (see paper)
28% identity, 43% coverage: 89:278/442 of query aligns to 114:305/459 of 2ptqA
Sites not aligning to the query:
2ptrA Crystal structure of escherichia coli adenylosuccinate lyase mutant h171a with bound adenylosuccinate substrate (see paper)
28% identity, 43% coverage: 89:278/442 of query aligns to 114:305/454 of 2ptrA
Sites not aligning to the query:
1fuqA Fumarase with bound 3-trimethylsilylsuccinic acid (see paper)
30% identity, 49% coverage: 74:290/442 of query aligns to 118:337/456 of 1fuqA
Sites not aligning to the query:
1fuoA FumarasE C with bound citrate (see paper)
30% identity, 49% coverage: 74:290/442 of query aligns to 118:337/456 of 1fuoA
Sites not aligning to the query:
1fupA Fumarase with bound pyromellitic acid (see paper)
30% identity, 49% coverage: 74:290/442 of query aligns to 117:336/455 of 1fupA
Sites not aligning to the query:
P05042 Fumarate hydratase class II; Fumarase C; Aerobic fumarase; Iron-independent fumarase; EC 4.2.1.2 from Escherichia coli (strain K12) (see 4 papers)
30% identity, 49% coverage: 74:290/442 of query aligns to 121:340/467 of P05042
P08417 Fumarate hydratase, mitochondrial; Fumarase; EC 4.2.1.2 from Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast) (see 2 papers)
23% identity, 80% coverage: 74:428/442 of query aligns to 141:486/488 of P08417
Sites not aligning to the query:
>RR42_RS32055 FitnessBrowser__Cup4G11:RR42_RS32055
MFGSAATLAAFSDTATVQRMLDFEAALARAEASCGVIPADAAEAIAATCRAGEIDFDALA
AAAVAGGNLAIPLVRQLTARVAARDAQAARYVHWGATSQDAIDTGMVLQLREALQAVDAD
LKALGHACAALAAQHRDTPMVARTWLQHALPTTFGLKAAGWLDALRRDLRRLDAARAQAA
TLQFGGAAGTLASLGAAAPAVATALGSALSLAVAPTPWHAYRDRMVEVATTLGMLTGSLG
KIARDVSLMMQTEVAEVAEPTGPGRGGSSTMPHKRNPVGCAAVLTAAVRVPPLVATMLAG
MVQEHERALGGWQAEWDTLPQIVTLAAGALRQMLEVVGGLQVDAARMRANLGVTHGLILA
EAAMLELGGKIGRLPAHHLVEGACRRAVAEGTTLRQALGATLAEDAAHAGLMDAAALDRV
CDPANYAGQAAGFVDAVLAAWR
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory