Comparing RR42_RS33940 FitnessBrowser__Cup4G11:RR42_RS33940 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 14 hits to proteins with known functional sites (download)
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
56% identity, 98% coverage: 3:103/103 of query aligns to 1:101/102 of 5bokA
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
53% identity, 100% coverage: 1:103/103 of query aligns to 1:103/104 of P0A185
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
54% identity, 97% coverage: 4:103/103 of query aligns to 3:102/103 of 2qpzA
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
39% identity, 98% coverage: 1:101/103 of query aligns to 1:102/107 of Q8GI16
2i7fA Sphingomonas yanoikuyae b1 ferredoxin (see paper)
46% identity, 72% coverage: 29:102/103 of query aligns to 27:100/102 of 2i7fA
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
40% identity, 94% coverage: 5:101/103 of query aligns to 4:101/114 of 4nbbE
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
32% identity, 97% coverage: 4:103/103 of query aligns to 2:102/109 of 1fqtA
2e4pA Crystal structure of bpha3 (oxidized form) (see paper)
31% identity, 96% coverage: 5:103/103 of query aligns to 2:101/108 of 2e4pA
3dqyA Crystal structure of toluene 2,3-dioxygenase ferredoxin (see paper)
33% identity, 96% coverage: 5:103/103 of query aligns to 2:100/106 of 3dqyA
3gceA Ferredoxin of carbazole 1,9a-dioxygenase from nocardioides aromaticivorans ic177 (see paper)
41% identity, 79% coverage: 21:101/103 of query aligns to 19:101/104 of 3gceA
6icoA Pseudomonas putida cbb5 ndma with theophylline (see paper)
30% identity, 52% coverage: 20:73/103 of query aligns to 31:84/344 of 6icoA
Sites not aligning to the query:
6icnA Pseudomonas putida cbb5 ndma with caffeine (see paper)
30% identity, 52% coverage: 20:73/103 of query aligns to 31:84/344 of 6icnA
Sites not aligning to the query:
6icqA Pseudomonas putida cbb5 ndma ql mutant with theobromine (see paper)
30% identity, 52% coverage: 20:73/103 of query aligns to 31:84/334 of 6icqA
Sites not aligning to the query:
6ickA Pseudomonas putida cbb5 ndma (see paper)
30% identity, 52% coverage: 20:73/103 of query aligns to 31:84/330 of 6ickA
Sites not aligning to the query:
>RR42_RS33940 FitnessBrowser__Cup4G11:RR42_RS33940
MSKQWTQVIPLVAIPKDDVVAVNALGKEIALYSVGDAIYATDNACSHGNARLCDGFLDGH
EIECPLHQGKFDVRTGRAMCEPLTSDIQAYSVKVENGAVFVEL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory