Comparing RR42_RS34085 FitnessBrowser__Cup4G11:RR42_RS34085 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P77544 Glutathione S-transferase YfcF; EC 2.5.1.18 from Escherichia coli (strain K12) (see paper)
58% identity, 98% coverage: 1:206/210 of query aligns to 1:209/214 of P77544
4jbbA Crystal structure of glutathione s-transferase a6tby7(target efi- 507184) from klebsiella pneumoniae mgh 78578, gsh complex
59% identity, 96% coverage: 6:206/210 of query aligns to 4:207/208 of 4jbbA
3bbyA Crystal structure of glutathione s-transferase (np_416804.1) from escherichia coli k12 at 1.85 a resolution
57% identity, 96% coverage: 6:206/210 of query aligns to 4:189/191 of 3bbyA
4isdA Crystal structure of glutathione transferase homolog from burkholderia gl bgr1, target efi-501803, with bound glutathione
49% identity, 96% coverage: 6:207/210 of query aligns to 5:185/187 of 4isdA
4hojA Crystal structure of glutathione transferase homolog from neisseria gonorrhoeae, target efi-501841, with bound glutathione
32% identity, 87% coverage: 14:196/210 of query aligns to 7:181/197 of 4hojA
4qq7A Crystal structure of putative stringent starvation protein a from burkholderia cenocepacia with bound glutathione
30% identity, 87% coverage: 17:198/210 of query aligns to 12:190/204 of 4qq7A
Sites not aligning to the query:
7zvpA Crystal structure of poplar glutathione transferase u19 in complex with glutathione (see paper)
29% identity, 74% coverage: 14:169/210 of query aligns to 9:168/216 of 7zvpA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
32% identity, 60% coverage: 24:150/210 of query aligns to 17:145/212 of 2jl4A
Sites not aligning to the query:
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
32% identity, 60% coverage: 24:150/210 of query aligns to 17:145/212 of O86043
Sites not aligning to the query:
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
32% identity, 60% coverage: 24:150/210 of query aligns to 19:147/214 of 2v6kA
Sites not aligning to the query:
7dweA Crystal structure of a glutathione s-transferase sbgstu7 from salix babylonica in complex with glutathione
28% identity, 71% coverage: 16:164/210 of query aligns to 11:163/212 of 7dweA
4xt0A Crystal structure of beta-etherase ligf from sphingobium sp. Strain syk-6 (see paper)
34% identity, 48% coverage: 6:106/210 of query aligns to 3:103/243 of 4xt0A
Sites not aligning to the query:
8a0rA Crystal structure of poplar glutathione transferase u20 in complex with pinocembrin (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 6:162/215 of 8a0rA
Sites not aligning to the query:
8a0qA Crystal structure of poplar glutathione transferase u20 in complex with baicalein (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 6:162/215 of 8a0qA
Sites not aligning to the query:
8a0oA Crystal structure of poplar glutathione transferase u20 in complex with galangin (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 6:162/215 of 8a0oA
Sites not aligning to the query:
8a0iA Crystal structure of poplar glutathione transferase u20 in complex with glutathionylphenylacetophenone (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 6:162/215 of 8a0iA
Sites not aligning to the query:
8a08A Crystal structure of poplar glutathione transferase u20 in complex with glutathione (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 6:162/215 of 8a08A
8a0pA Crystal structure of poplar glutathione transferase u20 in complex with morin (see paper)
28% identity, 73% coverage: 12:164/210 of query aligns to 7:163/216 of 8a0pA
Sites not aligning to the query:
7y55A Crystal structure of a glutathione s-transferase tau1 from pinus densata in complex with gsh
36% identity, 41% coverage: 14:100/210 of query aligns to 10:95/224 of 7y55A
6gicB Crystal structure of glutathione transferase omega 2s from trametes versicolor in complex with oxyresveratrol
28% identity, 82% coverage: 16:188/210 of query aligns to 13:182/237 of 6gicB
>RR42_RS34085 FitnessBrowser__Cup4G11:RR42_RS34085
MPSTNLRLYADAQFASPYAMSAFVALHEKGLSFELVTIDLANNANREPGYAQSSLTQRVP
TLIHGSFALSESSAITEYLDEVFPGTSLYPKDAISRARARQVQAWLRSDLMPIRQERSTE
VVFYGAHAEPLSAAARTAAGKLFSACEVLLTDHSPDLFGEWCIADVDLALMLNRLVLNGD
AVPGRLADYAARQWQRPSVQRWVALNRPPL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory