Comparing RR42_RS36985 FitnessBrowser__Cup4G11:RR42_RS36985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4zv2A An ancestral arginine-binding protein bound to glutamine (see paper)
39% identity, 82% coverage: 32:252/270 of query aligns to 4:224/225 of 4zv2A
4zv1A An ancestral arginine-binding protein bound to arginine (see paper)
40% identity, 82% coverage: 32:252/270 of query aligns to 4:226/226 of 4zv1A
5eyfB Crystal structure of solute-binding protein from enterococcus faecium with bound glutamate
35% identity, 79% coverage: 45:256/270 of query aligns to 26:238/243 of 5eyfB
2yjpA Crystal structure of the solute receptors for l-cysteine of neisseria gonorrhoeae (see paper)
34% identity, 84% coverage: 28:253/270 of query aligns to 7:233/247 of 2yjpA
1xt8B Crystal structure of cysteine-binding protein from campylobacter jejuni at 2.0 a resolution (see paper)
32% identity, 84% coverage: 23:249/270 of query aligns to 5:232/251 of 1xt8B
6svfA Crystal structure of the p235gk mutant of argbp from t. Maritima (see paper)
35% identity, 84% coverage: 25:251/270 of query aligns to 3:227/229 of 6svfA
5t0wA Crystal structure of the ancestral amino acid-binding protein anccdt- 1, a precursor of cyclohexadienyl dehydratase
32% identity, 84% coverage: 25:251/270 of query aligns to 3:228/229 of 5t0wA
3vvfA Crystal structure of ttc0807 complexed with arginine (see paper)
33% identity, 84% coverage: 25:252/270 of query aligns to 10:235/241 of 3vvfA
3vveA Crystal structure of ttc0807 complexed with lysine (see paper)
33% identity, 84% coverage: 25:252/270 of query aligns to 10:235/241 of 3vveA
3vvdA Crystal structure of ttc0807 complexed with ornithine (see paper)
33% identity, 84% coverage: 25:252/270 of query aligns to 10:235/241 of 3vvdA
3vv5A Crystal structure of ttc0807 complexed with (s)-2-aminoethyl-l- cysteine (aec) (see paper)
33% identity, 84% coverage: 25:252/270 of query aligns to 6:231/237 of 3vv5A
2pvuA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 36:252/270 of query aligns to 9:225/235 of 2pvuA
2q2cA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 36:252/270 of query aligns to 5:221/231 of 2q2cA
2q2aA Crystal structures of the arginine-, lysine-, histidine-binding protein artj from the thermophilic bacterium geobacillus stearothermophilus (see paper)
31% identity, 80% coverage: 36:252/270 of query aligns to 15:231/241 of 2q2aA
P02911 Lysine/arginine/ornithine-binding periplasmic protein; LAO-binding protein from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) (see 4 papers)
29% identity, 91% coverage: 5:251/270 of query aligns to 7:253/260 of P02911
2ia4B Crystal structure of novel amino acid binding protein from shigella flexneri
28% identity, 94% coverage: 17:270/270 of query aligns to 1:266/278 of 2ia4B
2vhaA Debp (see paper)
28% identity, 94% coverage: 18:270/270 of query aligns to 1:265/276 of 2vhaA
6h2tA Glnh bound to glu, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 27:261/270 of query aligns to 47:285/288 of 6h2tA
6h20A Glnh bound to asn, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 27:261/270 of query aligns to 46:284/287 of 6h20A
6h1uA Glnh bound to asp, mycobacterium tuberculosis (see paper)
30% identity, 87% coverage: 27:261/270 of query aligns to 46:284/287 of 6h1uA
>RR42_RS36985 FitnessBrowser__Cup4G11:RR42_RS36985
MFKAALTLLTGLTVLASSPAMADRLDDIKKAGVLRVGVFDANPPFGFVEAGSITPVGLDV
DYAAEIAKRLGVKPEFRATNPANRIALLASQKADIVAANFTITDERRQQIGFSTPYFASG
LQFIARKGALKQADDLKAWRLGVDKGTTQETTLRQKYPDARVIAYDDSPLALSALRSGAI
QAFAQDGAKLGALLATLPNKDQFEISSFTLTREYMGVGVPKGEDRLTAEIDRILAGLEKD
GTAARIYDKWFGPKSTAPLARDFTIGSALK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory