Comparing SM_b20259 FitnessBrowser__Smeli:SM_b20259 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
2hmcA The crystal structure of dihydrodipicolinate synthase dapa from agrobacterium tumefaciens
89% identity, 97% coverage: 1:310/320 of query aligns to 5:314/314 of 2hmcA
Q8UGL3 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see paper)
34% identity, 72% coverage: 5:234/320 of query aligns to 1:226/294 of Q8UGL3
4i7wA Agrobacterium tumefaciens dhdps with lysine and pyruvate
34% identity, 72% coverage: 5:234/320 of query aligns to 1:226/294 of 4i7wA
Q07607 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; Protein MosA; EC 4.3.3.7 from Rhizobium meliloti (Ensifer meliloti) (Sinorhizobium meliloti) (see paper)
32% identity, 75% coverage: 5:243/320 of query aligns to 1:234/292 of Q07607
4fhaA Structure of dihydrodipicolinate synthase from streptococcus pneumoniae,bound to pyruvate and lysine
32% identity, 63% coverage: 9:210/320 of query aligns to 10:209/307 of 4fhaA
4pfmA Shewanella benthica dhdps with lysine and pyruvate
27% identity, 87% coverage: 5:282/320 of query aligns to 2:274/295 of 4pfmA
7mjfA Crystal structure of candidatus liberibacter solanacearum dihydrodipicolinate synthase with pyruvate and succinic semi-aldehyde bound in active site
30% identity, 78% coverage: 5:254/320 of query aligns to 1:250/296 of 7mjfA
7lvlA Dihydrodipicolinate synthase bound with allosteric inhibitor (s)- lysine from candidatus liberibacter solanacearum
30% identity, 78% coverage: 5:254/320 of query aligns to 1:250/296 of 7lvlA
5c55A Crystal structure of the y138f mutant of c.Glutamicum n- acetylneuraminic acid lyase in complex with pyruvate
31% identity, 69% coverage: 6:226/320 of query aligns to 2:226/307 of 5c55A
1o5kA Crystal structure of dihydrodipicolinate synthase (tm1521) from thermotoga maritima at 1.80 a resolution
28% identity, 69% coverage: 5:224/320 of query aligns to 2:222/295 of 1o5kA
Q9X1K9 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Thermotoga maritima (strain ATCC 43589 / DSM 3109 / JCM 10099 / NBRC 100826 / MSB8) (see paper)
28% identity, 69% coverage: 5:224/320 of query aligns to 1:221/294 of Q9X1K9
Q5HG25 4-hydroxy-tetrahydrodipicolinate synthase; HTPA synthase; EC 4.3.3.7 from Staphylococcus aureus (strain COL) (see paper)
31% identity, 67% coverage: 5:219/320 of query aligns to 4:216/295 of Q5HG25
3di1B Crystal structure of the staphylococcus aureus dihydrodipicolinate synthase-pyruvate complex (see paper)
31% identity, 67% coverage: 5:219/320 of query aligns to 4:216/291 of 3di1B
5ktlA Dihydrodipicolinate synthase from the industrial and evolutionarily important cyanobacteria anabaena variabilis. (see paper)
29% identity, 73% coverage: 6:238/320 of query aligns to 5:239/295 of 5ktlA
Q86XE5 4-hydroxy-2-oxoglutarate aldolase, mitochondrial; Dihydrodipicolinate synthase-like; DHDPS-like protein; Probable 2-keto-4-hydroxyglutarate aldolase; Probable KHG-aldolase; Protein 569272; EC 4.1.3.16 from Homo sapiens (Human) (see paper)
27% identity, 78% coverage: 6:254/320 of query aligns to 35:283/327 of Q86XE5
4dxvA Crystal structure of dihydrodipicolinate synthase from acinetobacter baumannii complexed with mg and cl ions at 1.80 a resolution
27% identity, 83% coverage: 6:270/320 of query aligns to 2:261/291 of 4dxvA
3u8gA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with oxalic acid at 1.80 a resolution
27% identity, 83% coverage: 6:270/320 of query aligns to 2:261/291 of 3u8gA
3tdfA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 2-ketobutanoic acid at 1.99 a resolution
27% identity, 83% coverage: 6:270/320 of query aligns to 2:261/291 of 3tdfA
3tceA Crystal structure of the complex of dihydrodipicolinate synthase from acinetobacter baumannii with 5-hydroxylysine at 2.6 a resolution
27% identity, 83% coverage: 6:270/320 of query aligns to 2:261/291 of 3tceA
3rk8A Crystal structure of the chloride inhibited dihydrodipicolinate synthase from acinetobacter baumannii complexed with pyruvate at 1.8 a resolution
27% identity, 83% coverage: 6:270/320 of query aligns to 2:261/291 of 3rk8A
>SM_b20259 FitnessBrowser__Smeli:SM_b20259
MKAKIFSGVIPALMTPGREDRTPDFDALVRKGKALIADGMSAVVYCGSMGDWPLLTDAQR
MEGVERLVKAGVPVIVGTGAVNTALAAAHAAHAQKVGAQGLMVIPRVLSRGPSIVAQKAH
FKAILAAAPDLPSVIYNSPYYGFATRADLFFALRAEHPNLVGFKEFGGNADMRYAAEHIT
SRDDGVSLMIGVDTAVFHGFVNCGATGAITGIGNVLPKEVIHLCNLSRAAAAGDVDARQR
AQELEQALAVLSSFDEGPDLVLYFKHMMVLKGDKEYTLHFNETDALTESQRGYVEAQFKL
FNTWYAEWSKLPGAVEKYKA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory