Comparing SM_b20316 FitnessBrowser__Smeli:SM_b20316 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
28% identity, 90% coverage: 34:333/333 of query aligns to 13:321/321 of 4pz0A
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
31% identity, 71% coverage: 42:279/333 of query aligns to 14:255/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
31% identity, 71% coverage: 42:279/333 of query aligns to 14:255/313 of 2h3hA
Sites not aligning to the query:
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
26% identity, 92% coverage: 28:333/333 of query aligns to 3:316/316 of 1tjyA
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
27% identity, 75% coverage: 41:289/333 of query aligns to 14:260/278 of 6guqA
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 67% coverage: 67:288/333 of query aligns to 43:266/289 of 5hqjA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
27% identity, 75% coverage: 41:289/333 of query aligns to 19:265/283 of 6gt9A
Sites not aligning to the query:
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
26% identity, 92% coverage: 28:333/333 of query aligns to 1:314/314 of 3t95A
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
26% identity, 91% coverage: 31:333/333 of query aligns to 4:315/315 of 3ejwA
5dteB Crystal structure of an abc transporter periplasmic solute binding protein (ipr025997) from actinobacillus succinogenes 130z(asuc_0081, target efi-511065) with bound d-allose
28% identity, 73% coverage: 27:270/333 of query aligns to 1:249/287 of 5dteB
1rpjA Crystal structure of d-allose binding protein from escherichia coli (see paper)
30% identity, 62% coverage: 67:273/333 of query aligns to 40:253/288 of 1rpjA
Sites not aligning to the query:
1gudA Hinge-bending motion of d-allose binding protein from escherichia coli: three open conformations (see paper)
30% identity, 62% coverage: 67:273/333 of query aligns to 40:253/288 of 1gudA
Sites not aligning to the query:
8wlbA X-ray structure of enterobacter cloacae allose-binding protein in complex with d-psicose (see paper)
29% identity, 62% coverage: 67:273/333 of query aligns to 40:253/288 of 8wlbA
Sites not aligning to the query:
8wl9A X-ray structure of enterobacter cloacae allose-binding protein in complex with d-ribose (see paper)
29% identity, 62% coverage: 67:273/333 of query aligns to 40:253/288 of 8wl9A
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
25% identity, 70% coverage: 31:263/333 of query aligns to 3:238/290 of 4wutA
Sites not aligning to the query:
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
24% identity, 62% coverage: 67:273/333 of query aligns to 42:253/321 of 4wzzA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
27% identity, 70% coverage: 75:307/333 of query aligns to 52:293/303 of 5dkvA
Sites not aligning to the query:
7e7mC Crystal structure analysis of the streptococcus agalactiae ribose binding protein rbsb
24% identity, 77% coverage: 35:289/333 of query aligns to 15:263/284 of 7e7mC
2ioyA Crystal structure of thermoanaerobacter tengcongensis ribose binding protein (see paper)
24% identity, 66% coverage: 71:289/333 of query aligns to 41:257/274 of 2ioyA
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
21% identity, 78% coverage: 29:287/333 of query aligns to 4:260/274 of 5xssA
>SM_b20316 FitnessBrowser__Smeli:SM_b20316
MSVYKKIAACTVALGALCAAQLAVAQDAPSVVTVVKVTGENWFTRMEEGVVAYGKDNPAV
STSQIGPAKADAAQQLRLIEDLVAKNVNAIAVVPMDPSALEGVFKRAMNRGIKIITHEAD
SLKNTQVDIEAFDNKVFGARFNEKLAECMGKSGKWTSFVGSLGSLTHVQWADGGAENAKK
YPEMELVSEKNESFNDANKAYEKAREILRKYPDIKGFQGGSAIDVIGIGRAVEEAGLVGK
VCVVGLGLPKDTAKYLESGAVQSISFWDPKDAGYVMNKVAQLVIEGKEITDGMDLGVPGY
NKVSVKNGPGDGIIVVGEAWVDVDKSNYSQYPF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory