SitesBLAST
Comparing SM_b20325 FitnessBrowser__Smeli:SM_b20325 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6jahA
- binding (2S)-heptane-1,2,7-triol: Y309 (≠ A329), E310 (= E330), K313 (= K333), R332 (≠ P352)
- binding propane-2,2-diol: D160 (= D180), W162 (= W182)
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D137), G173 (= G193), E228 (= E248), W246 (= W266), G283 (= G303), G284 (= G304), W285 (= W305), R354 (= R374)
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6jagA
- binding beta-D-fructofuranose: D9 (≠ N33), R47 (≠ Q69), F114 (≠ Y135), D116 (= D137), E228 (= E248), W246 (= W266), W285 (= W305), R321 (≠ N341)
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D137), G173 (= G193), E228 (= E248), W246 (= W266), G283 (= G303), G284 (= G304), W285 (= W305), R354 (= R374)
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6jadA
- binding alpha-D-glucopyranose: D68 (= D90), D116 (= D137), G173 (= G193), E228 (= E248), W246 (= W266), G283 (= G303), G284 (= G304), W285 (= W305), R354 (= R374)
- binding alpha-D-fructofuranose: D9 (≠ N33), R47 (≠ Q69), F114 (≠ Y135), D116 (= D137), Y248 (= Y268), W285 (= W305)
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6j9yA
- binding carbonate ion: E373 (≠ A393), K382 (≠ G402), D390 (≠ L410)
- binding alpha-D-glucopyranose: D9 (≠ N33), A42 (= A64), R47 (≠ Q69), D68 (= D90), D116 (= D137), D116 (= D137), G173 (= G193), E228 (= E248), W246 (= W266), G283 (= G303), G284 (= G304), W285 (= W305), W285 (= W305), R321 (≠ N341), R354 (= R374)
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6jaiA
- binding calcium ion: P247 (= P267), Y248 (= Y268), R321 (≠ N341)
- binding alpha-D-glucopyranose: V13 (vs. gap), T44 (≠ S66), D68 (= D90), G173 (= G193), E228 (= E248), W246 (= W266), G283 (= G303), G284 (= G304), W285 (= W305), W285 (= W305), R321 (≠ N341), R354 (= R374)
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 6:400/406 of 6jamA
- binding alpha-D-glucopyranose: D11 (≠ N33), T46 (≠ S66), R49 (≠ Q69), D70 (= D90), F116 (≠ Y135), D118 (= D137), D118 (= D137), G175 (= G193), E230 (= E248), W248 (= W266), Y250 (= Y268), G285 (= G303), G286 (= G304), W287 (= W305), W287 (= W305)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
48% identity, 92% coverage: 28:418/423 of query aligns to 4:398/404 of 6jb0A
- binding alpha-D-glucopyranose: D9 (≠ N33), T44 (≠ S66), R47 (≠ Q69), D68 (= D90), F114 (≠ Y135), D116 (= D137), D116 (= D137), G173 (= G193), E228 (= E248), W246 (= W266), W246 (= W266), Y248 (= Y268), G283 (= G303), G284 (= G304), R354 (= R374)
- binding 1,3-propandiol: E15 (≠ K37), R318 (≠ E338)
6dtqA Maltose bound t. Maritima male3 (see paper)
41% identity, 93% coverage: 25:418/423 of query aligns to 1:390/391 of 6dtqA
- binding alpha-D-glucopyranose: V11 (≠ T35), E14 (≠ N38), R46 (≠ Q69), D67 (= D90), D115 (= D137), D115 (= D137), G166 (= G193), E222 (= E248), W240 (= W266), W240 (= W266), G277 (= G304), W278 (= W305), W278 (= W305), Q316 (≠ N341), R349 (= R374)
- binding magnesium ion: T59 (≠ K82), D60 (= D83), D62 (= D85), E290 (= E315)
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
35% identity, 93% coverage: 26:418/423 of query aligns to 4:404/407 of 1eu8A
- binding alpha-D-glucopyranose: G12 (≠ S34), E16 (≠ N38), T43 (≠ A64), T45 (≠ S66), R48 (≠ Q69), D69 (= D90), Y120 (= Y135), D122 (= D137), G178 (= G193), E238 (= E248), W256 (= W266), Y258 (= Y268), G292 (= G303), G293 (= G304), W294 (= W305), R363 (= R374)
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
35% identity, 93% coverage: 26:418/423 of query aligns to 45:445/450 of Q7LYW7
- E57 (≠ N38) binding
- T84 (≠ A64) binding
- R89 (≠ Q69) binding
- D110 (= D90) binding
- Y161 (= Y135) binding
- D163 (= D137) binding
- Y217 (= Y191) binding
- E279 (= E248) binding
- W297 (= W266) binding
- Y299 (= Y268) binding
- G334 (= G304) binding
- W335 (= W305) binding
- W371 (≠ N341) binding
- R404 (= R374) binding
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
35% identity, 89% coverage: 43:418/423 of query aligns to 47:414/416 of A9CEY9
- S71 (= S66) binding
- D95 (= D90) binding
- D141 (= D137) binding
- G194 (= G193) binding
- T248 (≠ E248) binding
- G303 (= G304) binding ; binding
- W304 (= W305) binding ; binding
- R373 (= R374) binding ; binding
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
35% identity, 89% coverage: 43:418/423 of query aligns to 17:384/384 of 7yzsAAA
- binding 6-deoxy-6-sulfo-beta-D-glucopyranose: T40 (≠ S65), S41 (= S66), D65 (= D90), D111 (= D137), E163 (= E192), G164 (= G193), T218 (≠ E248), W236 (= W266), G272 (= G303), G273 (= G304), W274 (= W305), R343 (= R374)
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
35% identity, 89% coverage: 43:418/423 of query aligns to 19:386/389 of 7ofyA
- binding [(2S,3S,4S,5R,6S)-6-[(2R)-2,3-bis(oxidanyl)propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T42 (≠ S65), S43 (= S66), D67 (= D90), D113 (= D137), G166 (= G193), T220 (≠ E248), W238 (= W266), Y240 (= Y268), G274 (= G303), G275 (= G304), W276 (= W305), R345 (= R374)
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
35% identity, 89% coverage: 43:418/423 of query aligns to 18:384/390 of 7qhvAAA
- binding [(2~{S},3~{S},4~{S},5~{R},6~{S})-6-[(2~{S})-3-butanoyloxy-2-heptanoyloxy-propoxy]-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: N40 (≠ A64), T41 (≠ S65), S42 (= S66), D66 (= D90), F109 (≠ Y135), D111 (= D137), E163 (= E192), G164 (= G193), A217 (≠ Q247), T218 (≠ E248), D219 (≠ E249), W236 (= W266), G272 (= G303), G273 (= G304), W274 (= W305), R343 (= R374)
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
35% identity, 89% coverage: 43:418/423 of query aligns to 16:381/382 of 7yzuA
- binding [(2S,3S,4S,5R,6S)-6-methoxy-3,4,5-tris(oxidanyl)oxan-2-yl]methanesulfonic acid: T39 (≠ S65), S40 (= S66), D64 (= D90), D110 (= D137), E162 (= E192), G163 (= G193), T215 (≠ E248), W233 (= W266), G269 (= G303), G270 (= G304), W271 (= W305), R340 (= R374)
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
29% identity, 77% coverage: 49:375/423 of query aligns to 27:343/388 of 3k02A
- binding 4,6-dideoxy-4-{[(1S,2R,3R,4S,5S)-2,3,4-trihydroxy-5-(hydroxymethyl)cyclohexyl]amino}-alpha-D-allopyranosyl-(1->4)-alpha-D-glucopyranosyl-(1->4)-alpha-D-glucopyranosyl-(1->4)-alpha-D-glucopyranose: F43 (≠ S66), E67 (≠ D90), W70 (= W93), D117 (= D137), D164 (≠ A190), Y166 (≠ E192), W167 (≠ G193), W238 (≠ Y268), W274 (= W305), R342 (= R374)
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
29% identity, 77% coverage: 49:375/423 of query aligns to 27:343/388 of 3jzjA
- binding 4,6-dideoxy-4-{[(1S,4R,5S,6S)-4,5,6-trihydroxy-3-(hydroxymethyl)cyclohex-2-en-1-yl]amino}-alpha-D-glucopyranose: E67 (≠ D90), W70 (= W93), Y166 (≠ E192), R342 (= R374)
- binding alpha-D-glucopyranose: F43 (≠ S66), R65 (≠ Q88), E67 (≠ D90), D117 (= D137), D164 (≠ A190), W238 (≠ Y268), W238 (≠ Y268), W274 (= W305), W274 (= W305)
Sites not aligning to the query:
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
26% identity, 84% coverage: 48:402/423 of query aligns to 56:468/471 of G7CES0
- C57 (≠ F49) modified: Disulfide link with 375
- Q79 (= Q69) binding ; mutation to A: About 10-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- D100 (= D90) binding ; mutation to A: Structurally unstable.
- N154 (≠ D137) binding ; mutation to A: About 100-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- Y198 (= Y191) binding
- E261 (= E248) mutation to A: Loss of trehalose-binding.
- W279 (= W266) binding ; mutation to A: Loss of trehalose-binding.
- Y281 (= Y270) binding
- G354 (= G304) binding
- L355 (≠ W305) mutation to A: About 13-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.
- C375 (≠ F325) modified: Disulfide link with 57
- R424 (vs. gap) binding ; mutation to A: Loss of trehalose-binding.
Sites not aligning to the query:
- 45 binding ; N→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; N→T: Increased trehalose-binding; when associated with D-46.
- 46 binding ; E→A: About 3-fold increase in constant dissociation (Kd) value of trehalose compared to wild-type.; E→D: Increased trehalose-binding; when associated with T-45.
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
26% identity, 82% coverage: 56:402/423 of query aligns to 33:435/435 of 7apeA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
26% identity, 88% coverage: 47:418/423 of query aligns to 26:398/399 of 5iaiA
Sites not aligning to the query:
Query Sequence
>SM_b20325 FitnessBrowser__Smeli:SM_b20325
MNVKPFVRTLISCAAIAGAIDLAAAAELSMAANSTGKNLSFLRDQIARFEKETGHKVNLV
TMPASSSEQFSQYRLWLAAGNKDVDVYQTDVIWAPQLAEQFVDLTEATKDVVGEHFPSII
QSQTVNGKLVALPFYTDAPALYYRKDLLDKYGKTPPKTWDELAATAKEVQDKERAAGSAD
IWGFVFQGNAYEGLTCNALEWIKSSGGGQIIEPDGTISVNNEKAAAAVEKVKEWIGTIAP
KGVLAYQEEESRGVWQTGNAVFMRNWPYAYALGNGDDSAVKGKFEVAPLPAATDGDQPSS
TLGGWNLAVSKYSDEQEAAIAFVKFLGSAETQKVRAIELSNLPTIAALYDDPEVAAAQPF
MPHWKPIFQSAVPRPSAVAKVKYNEVSSKFWSAVHNTLSGNGTAAENLELLEVELTELKG
DAW
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory