Comparing SM_b20499 FitnessBrowser__Smeli:SM_b20499 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
2r46A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phosphopyruvic acid. (see paper)
30% identity, 81% coverage: 41:509/577 of query aligns to 29:471/495 of 2r46A
Sites not aligning to the query:
2r45A Crystal structure of escherichia coli glycerol-3-phosphate dehydrogenase in complex with 2-phospho-d-glyceric acid (see paper)
30% identity, 81% coverage: 41:509/577 of query aligns to 29:471/495 of 2r45A
Sites not aligning to the query:
2qcuB Crystal structure of glycerol-3-phosphate dehydrogenase from escherichia coli (see paper)
30% identity, 81% coverage: 41:509/577 of query aligns to 29:471/501 of 2qcuB
Sites not aligning to the query:
Q9SS48 Glycerol-3-phosphate dehydrogenase SDP6, mitochondrial; Protein SUGAR-DEPENDENT 6; EC 1.1.5.3 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 93% coverage: 13:551/577 of query aligns to 71:612/629 of Q9SS48
2rgoA Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
24% identity, 89% coverage: 38:551/577 of query aligns to 41:547/557 of 2rgoA
Sites not aligning to the query:
3da1A X-ray structure of the glycerol-3-phosphate dehydrogenase from bacillus halodurans complexed with fad. Northeast structural genomics consortium target bhr167.
22% identity, 90% coverage: 36:552/577 of query aligns to 39:486/496 of 3da1A
Sites not aligning to the query:
2rgoB Structure of alpha-glycerophosphate oxidase from streptococcus sp.: A template for the mitochondrial alpha-glycerophosphate dehydrogenase (see paper)
23% identity, 89% coverage: 38:551/577 of query aligns to 39:518/530 of 2rgoB
Sites not aligning to the query:
>SM_b20499 FitnessBrowser__Smeli:SM_b20499
MTRTEILDGLRQSPKVDVCVLGGGINGLSVFRELALQGVRVLLVEKHDYCSGASAALSRM
VHGGLRYLENGEFTLVKESLVERDRLLRNAPHLVSPLATTVPVFDIFSGLANGIVRFLGL
SRRPSRRGAIAIKAGLSIYDLLTRKRALMPRHRFRGRRATLAKWPALNPKIRSSATYYDA
WVSHPERIGMELLQDGLSASTEAAALNYAELRRNEAGTYIIADDVEGVSVEIEPSLIVNA
TGGWIDITNGALLPPDHRSAPLMGGTKGSHLIIDNVHLRDALGDHMIYYENEDGRICILF
PYFGKVLVGSTDIRVDDPGTVRCEEEERDYILQSLAFVLPGIEIGPEEIVYKFSGVRPLP
ASSDSFTGRIPRDHFCTMIESAGTPVLCMIGGKWTTFRSFGELAADTVLERLGLPRRTST
ADRAIGGGRRFPADRESWIAALAARCGLPPPHVAELFSRYGTEAEALAAFIGQGSDAAIP
GAGHTMRELLFLIRNEAVEHLDDLLLRRTTLAISGTLSLAILDAALELLTGEKGWSEARS
LSERNRCLALLRDRHGVDEKALAARMPPPLAKAVAAG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory