Comparing SM_b20508 FitnessBrowser__Smeli:SM_b20508 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 7 hits to proteins with known functional sites (download)
4kzkA The structure of the periplasmic l-arabinose binding protein from burkholderia thailandensis
57% identity, 92% coverage: 26:326/327 of query aligns to 1:301/301 of 4kzkA
5abpA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
48% identity, 92% coverage: 25:325/327 of query aligns to 1:303/305 of 5abpA
1abfA Substrate specificity and affinity of a protein modulated by bound water molecules (see paper)
48% identity, 92% coverage: 25:325/327 of query aligns to 1:303/305 of 1abfA
1abeA Novel stereospecificity of the l-arabinose-binding protein (see paper)
48% identity, 92% coverage: 25:325/327 of query aligns to 1:303/305 of 1abeA
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
26% identity, 73% coverage: 27:266/327 of query aligns to 3:234/292 of 2fn8A
Sites not aligning to the query:
4ry9B Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
26% identity, 66% coverage: 27:243/327 of query aligns to 4:216/297 of 4ry9B
Sites not aligning to the query:
4ry9A Crystal structure of carbohydrate transporter solute binding protein veis_2079 from verminephrobacter eiseniae ef01-2, target efi-511009, a complex with d-talitol
26% identity, 66% coverage: 27:243/327 of query aligns to 4:216/297 of 4ry9A
Sites not aligning to the query:
>SM_b20508 FitnessBrowser__Smeli:SM_b20508
MRFIKAVALAGTVAIFAATSAFAADVKIGFIVKQPEEPWFQDEWKFADEAAKEKGFTLVK
IGAQDGEKVQSAIDNLGAQGAQGFIICTPDVKLGPGIVAKAAANDLKLMTVDDRLVNADG
SPIEDVPHMGISATKIGEAVGEAIVAEIKKRGWDMKEVGAIRVSYDQLPTAVDRVEGALS
VLKANGFPEANVFDAPQAKTDTEAALNAATVVLNKNAGIKKWVAVGLNDEAVLGAVRATE
TVGIPADSMIGIGIGGADSAINEFKKPSATGFFGTVIISPKRHGYETALNMYEWIANGKE
PEKLILTAGQLALRDNYEAVRKELGIE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory