Comparing SM_b20985 FitnessBrowser__Smeli:SM_b20985 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P0A185 Naphthalene 1,2-dioxygenase system, ferredoxin component from Pseudomonas putida (Arthrobacter siderocapsulatus) (see 2 papers)
31% identity, 92% coverage: 1:103/112 of query aligns to 1:103/104 of P0A185
2qpzA Naphthalene 1,2-dioxygenase rieske ferredoxin (see paper)
30% identity, 91% coverage: 2:103/112 of query aligns to 1:102/103 of 2qpzA
4qdfB Crystal structure of apo ksha5 and ksha1 in complex with 1,4-30q-coa from r. Rhodochrous (see paper)
33% identity, 59% coverage: 5:70/112 of query aligns to 8:73/357 of 4qdfB
Sites not aligning to the query:
F1CMX0 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
33% identity, 59% coverage: 5:70/112 of query aligns to 27:92/394 of F1CMX0
Sites not aligning to the query:
5bokA Ferredoxin component of 3-nitrotoluene dioxygenase from diaphorobacter sp. Strain ds2
26% identity, 90% coverage: 4:104/112 of query aligns to 2:102/102 of 5bokA
4qckA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis in complex with 4-androstene-3,17-dione (see paper)
42% identity, 38% coverage: 28:70/112 of query aligns to 36:78/355 of 4qckA
Sites not aligning to the query:
2zylA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase (ksha) from m. Tuberculosis (see paper)
42% identity, 38% coverage: 28:70/112 of query aligns to 36:78/359 of 2zylA
Sites not aligning to the query:
P71875 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
42% identity, 38% coverage: 28:70/112 of query aligns to 49:91/386 of P71875
Sites not aligning to the query:
Q17938 Cholesterol 7-desaturase; Cholesterol desaturase daf-36; Rieske oxygenase DAF-36/Neverland; DAF-36/NVD; EC 1.14.19.21 from Caenorhabditis elegans (see paper)
32% identity, 53% coverage: 29:87/112 of query aligns to 105:167/428 of Q17938
Sites not aligning to the query:
A0R635 Putative Rieske 2Fe-2S iron-sulfur protein MSMEG_6410/MSMEI_6242; EC 1.-.-.- from Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) (Mycobacterium smegmatis) (see paper)
38% identity, 51% coverage: 32:88/112 of query aligns to 450:514/518 of A0R635
Sites not aligning to the query:
4qddA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase 5 (ksha5) from r. Rhodochrous in complex with 1,4-30q-coa (see paper)
28% identity, 78% coverage: 5:91/112 of query aligns to 18:101/366 of 4qddA
Sites not aligning to the query:
4qdcA Crystal structure of 3-ketosteroid-9-alpha-hydroxylase 5 (ksha5) from r. Rhodochrous in complex with fe2/s2 (inorganic) cluster (see paper)
28% identity, 78% coverage: 5:91/112 of query aligns to 18:101/369 of 4qdcA
Sites not aligning to the query:
1fqtA Crystal structure of the rieske-type ferredoxin associated with biphenyl dioxygenase (see paper)
30% identity, 96% coverage: 3:109/112 of query aligns to 1:108/109 of 1fqtA
F1CMY8 3-ketosteroid-9-alpha-monooxygenase, oxygenase component; 3-ketosteroid-9-alpha-hydroxylase, oxygenase component; KSH; Androsta-1,4-diene-3,17-dione 9-alpha-hydroxylase; Rieske-type oxygenase; RO; EC 1.14.15.30 from Rhodococcus rhodochrous (see paper)
28% identity, 78% coverage: 5:91/112 of query aligns to 32:115/390 of F1CMY8
Sites not aligning to the query:
6wnbA Structure of the rieske non-heme iron oxygenase sxtt with dideoxysaxitoxin bound (see paper)
29% identity, 60% coverage: 4:70/112 of query aligns to 10:78/320 of 6wnbA
Sites not aligning to the query:
7szhA Structure of the rieske non-heme iron oxygenase sxtt with beta- saxitoxinol bound (see paper)
29% identity, 60% coverage: 4:70/112 of query aligns to 9:77/323 of 7szhA
Sites not aligning to the query:
6wn3B Structure of the rieske non-heme iron oxygenase sxtt (see paper)
29% identity, 60% coverage: 4:70/112 of query aligns to 11:79/328 of 6wn3B
Sites not aligning to the query:
Q8GI16 Ferredoxin CarAc; Carbazole 1,9a-dioxygenase, ferredoxin component; CARDO from Pseudomonas resinovorans (see 2 papers)
31% identity, 69% coverage: 1:77/112 of query aligns to 1:77/107 of Q8GI16
4nbbE Carbazole- and oxygen-bound oxygenase with ile262 replaced by val and ferredoxin complex of carbazole 1,9a-dioxygenase (see paper)
31% identity, 65% coverage: 5:77/112 of query aligns to 4:76/114 of 4nbbE
7szfA Structure of the rieske non-heme iron oxygenase gxta with beta- saxitoxinol bound (see paper)
30% identity, 60% coverage: 4:70/112 of query aligns to 10:78/318 of 7szfA
Sites not aligning to the query:
>SM_b20985 FitnessBrowser__Smeli:SM_b20985
MTMNWIAIGDINDIPLRGARCVRTPTGKIAVFRTAHDEVFAIEDHCPHKGGPLSQGIVHG
TAVTCPLHNWVISLETGKALGADEGEVRTIPIRNDNGALFVALESLALAAAE
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory