Comparing SM_b21016 FitnessBrowser__Smeli:SM_b21016 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 19 hits to proteins with known functional sites (download)
3ejwA Crystal structure of the sinorhizobium meliloti ai-2 receptor, smlsrb (see paper)
100% identity, 92% coverage: 29:343/343 of query aligns to 1:315/315 of 3ejwA
3t95A Crystal structure of lsrb from yersinia pestis complexed with autoinducer-2 (see paper)
77% identity, 91% coverage: 31:343/343 of query aligns to 3:314/314 of 3t95A
1tjyA Crystal structure of salmonella typhimurium ai-2 receptor lsrb in complex with r-thmf (see paper)
76% identity, 91% coverage: 31:343/343 of query aligns to 5:316/316 of 1tjyA
4pz0A The crystal structure of a solute binding protein from bacillus anthracis str. Ames in complex with quorum-sensing signal autoinducer-2 (ai-2)
61% identity, 91% coverage: 31:343/343 of query aligns to 9:321/321 of 4pz0A
6dspA Lsrb from clostridium saccharobutylicum in complex with ai-2 (see paper)
44% identity, 91% coverage: 32:343/343 of query aligns to 3:326/326 of 6dspA
4wzzA Crystal structure of an abc transporter solute binding protein (ipr025997) from clostridium phytofermentas (cphy_0583, target efi- 511148) with bound l-rhamnose
26% identity, 76% coverage: 33:291/343 of query aligns to 8:268/321 of 4wzzA
3c6qC Apo and ligand-bound form of a thermophilic glucose/xylose binding protein
28% identity, 63% coverage: 50:264/343 of query aligns to 21:231/305 of 3c6qC
Sites not aligning to the query:
2h3hA Crystal structure of the liganded form of thermotoga maritima glucose binding protein (see paper)
28% identity, 63% coverage: 50:264/343 of query aligns to 21:231/313 of 2h3hA
Sites not aligning to the query:
5hqjA Crystal structure of abc transporter solute binding protein b1g1h7 from burkholderia graminis c4d1m, target efi-511179, in complex with d-arabinose
28% identity, 59% coverage: 32:232/343 of query aligns to 9:205/289 of 5hqjA
Sites not aligning to the query:
6guqA Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with glucose
23% identity, 68% coverage: 31:263/343 of query aligns to 3:232/278 of 6guqA
Sites not aligning to the query:
6gt9A Crystal structure of ganp, a glucose-galactose binding protein from geobacillus stearothermophilus, in complex with galactose
23% identity, 68% coverage: 31:263/343 of query aligns to 8:237/283 of 6gt9A
Sites not aligning to the query:
4wutA Crystal structure of an abc transporter solute binding protein (ipr025997) from agrobacterium vitis (avi_5133, target efi-511220) with bound d-fucose
34% identity, 29% coverage: 31:129/343 of query aligns to 2:102/290 of 4wutA
Sites not aligning to the query:
5dkvA Crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
22% identity, 68% coverage: 31:263/343 of query aligns to 8:247/303 of 5dkvA
Sites not aligning to the query:
4ry8B Crystal structure of 5-methylthioribose transporter solute binding protein tlet_1677 from thermotoga lettingae tmo target efi-511109 in complex with 5-methylthioribose
31% identity, 30% coverage: 31:132/343 of query aligns to 11:110/321 of 4ry8B
Sites not aligning to the query:
5ibqA Crystal structure of an abc solute binding protein from rhizobium etli cfn 42 (rhe_pf00037,target efi-511357) in complex with alpha-d-apiose
24% identity, 72% coverage: 43:288/343 of query aligns to 16:257/287 of 5ibqA
Sites not aligning to the query:
4ry0A Crystal structure of ribose transporter solute binding protein rhe_pf00037 from rhizobium etli cfn 42, target efi-511357, in complex with d-ribose
24% identity, 72% coverage: 43:288/343 of query aligns to 16:257/287 of 4ry0A
Sites not aligning to the query:
7x0hA Crystal structure of sugar binding protein cbpa complexed wtih glucose from clostridium thermocellum (see paper)
27% identity, 30% coverage: 30:133/343 of query aligns to 8:111/287 of 7x0hA
Sites not aligning to the query:
5xssA Xylfii molecule (see paper)
24% identity, 66% coverage: 36:263/343 of query aligns to 4:234/274 of 5xssA
Sites not aligning to the query:
2fn8A Thermotoga maritima ribose binding protein ribose bound form (see paper)
25% identity, 60% coverage: 43:249/343 of query aligns to 15:223/292 of 2fn8A
Sites not aligning to the query:
>SM_b21016 FitnessBrowser__Smeli:SM_b21016
MIKTIMKSSALAAALLAGTVLASGAAHAENQIAFIPKLVGVGFFTSGGAGAVKAGEEVGA
KVTYDGPTEPSVSGQVQFINNFVNQGYNALIVSSVSPDGLCPALKRAMERGVLVMTWDSD
VNPDCRSYYINQGTPEQLGGLLVDMAAEGVKKEKAKVAFFYSSPTVTDQNAWAEAAKAKI
AKEHPGWEIVTTQYGYNDAQKSLQTAESILQTYPDLDAIIAPDANALPAAAQAAENLKRA
EGVTIVGFSTPNVMRPYIERGTIQRFGLWDVTQQGKISVFVADHVLKNGPMKVGEKLEIP
GVGTVEVSANKVQGYDYEADGNGIILLPERTVFTKENIGNFDF
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory