Comparing SM_b21103 FitnessBrowser__Smeli:SM_b21103 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dtqA Maltose bound t. Maritima male3 (see paper)
31% identity, 77% coverage: 97:433/439 of query aligns to 72:391/391 of 6dtqA
Sites not aligning to the query:
4qrzA Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
29% identity, 76% coverage: 95:428/439 of query aligns to 65:377/383 of 4qrzA
Sites not aligning to the query:
4qsdA Crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound sucrose
29% identity, 76% coverage: 95:428/439 of query aligns to 65:377/382 of 4qsdA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
29% identity, 59% coverage: 175:433/439 of query aligns to 137:391/393 of 5ci5A
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
26% identity, 72% coverage: 118:434/439 of query aligns to 95:406/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
27% identity, 72% coverage: 118:434/439 of query aligns to 136:447/450 of Q7LYW7
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
25% identity, 73% coverage: 116:434/439 of query aligns to 83:386/390 of 7qhvAAA
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
26% identity, 69% coverage: 117:420/439 of query aligns to 114:402/416 of A9CEY9
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
25% identity, 72% coverage: 117:434/439 of query aligns to 86:388/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
26% identity, 69% coverage: 117:420/439 of query aligns to 84:372/384 of 7yzsAAA
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6jahA
Sites not aligning to the query:
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6j9yA
Sites not aligning to the query:
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6jb0A
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 83:402/406 of 6jamA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
26% identity, 69% coverage: 117:420/439 of query aligns to 83:369/382 of 7yzuA
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
25% identity, 74% coverage: 109:434/439 of query aligns to 81:400/404 of 6jaiA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
27% identity, 48% coverage: 219:429/439 of query aligns to 186:395/399 of 5iaiA
Sites not aligning to the query:
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
25% identity, 83% coverage: 75:437/439 of query aligns to 43:414/417 of 4ryaA
Sites not aligning to the query:
>SM_b21103 FitnessBrowser__Smeli:SM_b21103
MNRLLSGVSAGVIMLACAMGAAKAADLPGKFEGVTIDAKLIGGQQYEKLYERIGEWEKAT
GAKVNILSKKNHFELDKEIKSDIATGGLTWCVGSNHSSFAPQYPDIYADLFGLIPSEEVA
KFVPAVIDASTLEGKLVMLPRAQFDVSALYFQKSLYQDEAKKTEFKAKYGYDLAPPDTWA
QVSDQAEFFAAPPNFYGTQFAGKEEAINGRFYEMLVAEGGEYLDKDGRPAFNSDAGVRAL
EWFVKLYKDKAVPPGTTNYLWDDLGQGFASGSIAVNLDWPGWASFFNDPKSSKVAGNVGV
KVQPAGSSGKRTGWSGHHGFSVTESCADKEAAASLVWWLTNEDSQKLESAAGPLPTRSAV
WDFNIKAAEGDAYKTEVLQAFQEAAKHAFPVPQTAEWIEISNAVYPELQAAILGDKTSKE
ALDAAAEKATGILEDAGKL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory