Comparing SM_b21221 FitnessBrowser__Smeli:SM_b21221 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6dtqA Maltose bound t. Maritima male3 (see paper)
32% identity, 89% coverage: 44:408/412 of query aligns to 18:385/391 of 6dtqA
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
30% identity, 98% coverage: 8:410/412 of query aligns to 19:442/450 of Q7LYW7
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
31% identity, 81% coverage: 78:410/412 of query aligns to 57:401/407 of 1eu8A
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
29% identity, 98% coverage: 2:404/412 of query aligns to 3:405/416 of A9CEY9
7qhvAAA Sulfoquinovosyl binding protein (see paper)
28% identity, 87% coverage: 45:404/412 of query aligns to 18:375/390 of 7qhvAAA
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
28% identity, 87% coverage: 45:404/412 of query aligns to 19:377/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
28% identity, 87% coverage: 45:404/412 of query aligns to 17:375/384 of 7yzsAAA
Sites not aligning to the query:
5ci5A Crystal structure of an abc transporter solute binding protein from thermotoga lettingae tmo (tlet_1705, target efi-510544) bound with alpha-d-tagatose
29% identity, 85% coverage: 58:409/412 of query aligns to 32:386/393 of 5ci5A
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
28% identity, 87% coverage: 45:404/412 of query aligns to 16:372/382 of 7yzuA
Sites not aligning to the query:
4qrzA Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
26% identity, 88% coverage: 51:412/412 of query aligns to 23:380/383 of 4qrzA
Sites not aligning to the query:
4qsdA Crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound sucrose
26% identity, 88% coverage: 51:412/412 of query aligns to 23:380/382 of 4qsdA
Sites not aligning to the query:
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6jb0A
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6jahA
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6j9yA
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 65:391/406 of 6jamA
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
26% identity, 78% coverage: 85:404/412 of query aligns to 63:389/404 of 6jaiA
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
24% identity, 91% coverage: 28:400/412 of query aligns to 2:364/386 of 5ysbA
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
24% identity, 91% coverage: 28:400/412 of query aligns to 3:365/387 of 5ysdA
>SM_b21221 FitnessBrowser__Smeli:SM_b21221
MLKSTRNALIGATLIGAGFTGHAQAETTLNALFMAQAAYSEADVRAMTDAFAKANPDIKV
NLEFVPYEGLHDKTVLAQGSGGGYDVVLFDVIWPAEYAANNVLLDVTDRVTDEMNKGVLP
GAWTTVEYDGKRYGMPWILDTKYLFYNKEILEKAGIKQPPKTWEELSEQATAIKDKGLLE
SPIAWSWSQAEAAICDYTTLVSAYGGKFLDGGKPAFTTGGGLDALNYMVTSYTSGLTNPN
SKEFLEEDVRKVFQNGEAAFALNWTYMYNLANDPKESKVAGKVGVVPAPGAAGKSEVSAV
NGSMGLGITATSKHPEEAWKYIVHMTSQETQNAYAKLSLPIWASSYENPNVTKGQEELIA
AAKRGLAAMYPRPTTPKYQELSTALQQAIQEALLGQSSAEDALKSAAENSGL
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory