Comparing SM_b21461 FitnessBrowser__Smeli:SM_b21461 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6jb0A Crystal structure of abc transporter alpha-glycoside-binding mutant protein w287a in complex with trehalose (see paper)
43% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6jb0A
Sites not aligning to the query:
6jahA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with glucose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6jahA
6jagA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with sucrose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6jagA
Sites not aligning to the query:
6jadA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with palatinose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6jadA
Sites not aligning to the query:
6j9yA Crystal structure of abc transporter alpha-glycoside-binding protein in complex with maltose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6j9yA
Sites not aligning to the query:
6jamA Crystal structure of abc transporter alpha-glycoside-binding mutant protein r356a in complex with trehalose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 22:402/406 of 6jamA
Sites not aligning to the query:
6jaiA Crystal structure of abc transporter alpha-glycoside-binding mutant protein d118a in complex with maltose (see paper)
42% identity, 90% coverage: 39:418/420 of query aligns to 20:400/404 of 6jaiA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
37% identity, 85% coverage: 53:409/420 of query aligns to 33:390/391 of 6dtqA
Sites not aligning to the query:
1eu8A Structure of trehalose maltose binding protein from thermococcus litoralis (see paper)
39% identity, 82% coverage: 76:418/420 of query aligns to 58:406/407 of 1eu8A
Sites not aligning to the query:
Q7LYW7 Trehalose/maltose-binding protein MalE; TMBP from Thermococcus litoralis (strain ATCC 51850 / DSM 5473 / JCM 8560 / NS-C) (see paper)
39% identity, 81% coverage: 77:418/420 of query aligns to 100:447/450 of Q7LYW7
Sites not aligning to the query:
A9CEY9 Sulfoquinovosyl glycerol-binding protein SmoF; SQGro-binding protein SmoF; SQ monooxygenase cluster protein F from Agrobacterium fabrum (strain C58 / ATCC 33970) (Agrobacterium tumefaciens (strain C58)) (see 2 papers)
32% identity, 82% coverage: 73:415/420 of query aligns to 81:416/416 of A9CEY9
Sites not aligning to the query:
7ofyA Crystal structure of sq binding protein from agrobacterium tumefaciens in complex with sulfoquinovosyl glycerol (sqgro) (see paper)
32% identity, 82% coverage: 73:415/420 of query aligns to 53:388/389 of 7ofyA
Sites not aligning to the query:
7yzsAAA Sulfoquinovosyl binding protein (see paper)
32% identity, 82% coverage: 73:415/420 of query aligns to 51:383/384 of 7yzsAAA
Sites not aligning to the query:
7qhvAAA Sulfoquinovosyl binding protein (see paper)
32% identity, 82% coverage: 73:415/420 of query aligns to 52:386/390 of 7qhvAAA
Sites not aligning to the query:
7yzuA Crystal structure of the sulfoquinovosyl binding protein smof complexed with sqme (see paper)
32% identity, 82% coverage: 73:415/420 of query aligns to 50:380/382 of 7yzuA
Sites not aligning to the query:
5iaiA Crystal structure of abc transporter solute binding protein arad_9887 from agrobacterium radiobacter k84, target efi-510945 in complex with ribitol
24% identity, 86% coverage: 38:398/420 of query aligns to 20:380/399 of 5iaiA
Sites not aligning to the query:
7apeA Crystal structure of lpqy from mycobacterium thermoresistible in complex with trehalose (see paper)
23% identity, 83% coverage: 27:374/420 of query aligns to 5:393/435 of 7apeA
G7CES0 Trehalose-binding lipoprotein LpqY; Extracellular solute-binding protein; SugABC transporter substrate-binding protein LpqY; SugABC transporter SBP LpqY from Mycolicibacterium thermoresistibile (strain ATCC 19527 / DSM 44167 / CIP 105390 / JCM 6362 / NCTC 10409 / 316) (Mycobacterium thermoresistibile) (see paper)
23% identity, 83% coverage: 27:374/420 of query aligns to 38:426/471 of G7CES0
7cafE Mycobacterium smegmatis lpqy-sugabc complex in the pre-translocation state (see paper)
24% identity, 77% coverage: 53:374/420 of query aligns to 38:398/443 of 7cafE
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
25% identity, 89% coverage: 44:415/420 of query aligns to 20:383/386 of 5ysbA
Sites not aligning to the query:
>SM_b21461 FitnessBrowser__Smeli:SM_b21461
MKHMLKTLAGMTVFAVASAFPAKADTVSMFCSATDYELCEKAVQKWTNDTGHEVKLNRMP
QNLDDAIPIYQQLFAAQSSDMDVLYIDVIWLGMFKDHLLDLTSLVPENEVTAHFASAADA
ARLDGKLLSMPFYIDTGLMFYRKDLLEKYGKQPPKTWDELTATAKEIQDAERKAGSPDIW
GYSWQGRSYEGLTCDALEWIASAGGGTILSGDGEVTINNPQTEAALTRARGWIGTISPEG
VLNYDEENSRALFESGNAVFHRNWPYVWGTSQAEGGKLVGKVGVSALPVGAEGQKSSGAL
GTAYLGVSKYSKKPELAAELLRYMVGAEDQKMRAIEGGYNPTVEALYEDADVLAKIPFLG
MAKAAFEESVARPSAATGKNYNRVSRTFYRAVHDIISGKDDVAKELADLERRLERDVKAK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory