Comparing SM_b21652 FitnessBrowser__Smeli:SM_b21652 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
6h0hA The abc transporter associated binding protein from b. Animalis subsp. Lactis bl-04 in complex with beta-1,6-galactobiose (see paper)
28% identity, 70% coverage: 31:326/424 of query aligns to 3:295/410 of 6h0hA
8bfyA Abc transporter binding protein cebe from streptomyces scabiei in complex with cellotriose (see paper)
27% identity, 66% coverage: 42:319/424 of query aligns to 9:287/393 of 8bfyA
Sites not aligning to the query:
6dtuA Maltotetraose bound t. Maritima male1 (see paper)
26% identity, 73% coverage: 32:340/424 of query aligns to 4:299/375 of 6dtuA
Sites not aligning to the query:
6dtsA Maltotetraose bound t. Maritima male2 (see paper)
24% identity, 73% coverage: 32:340/424 of query aligns to 2:297/379 of 6dtsA
Sites not aligning to the query:
5ysdB Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
25% identity, 67% coverage: 47:331/424 of query aligns to 16:295/389 of 5ysdB
Sites not aligning to the query:
5ysdA Crystal structure of beta-1,2-glucooligosaccharide binding protein in complex with sophorotriose (see paper)
25% identity, 67% coverage: 47:331/424 of query aligns to 16:295/387 of 5ysdA
Sites not aligning to the query:
5ysbA Crystal structure of beta-1,2-glucooligosaccharide binding protein in ligand-free form (see paper)
25% identity, 67% coverage: 47:331/424 of query aligns to 15:294/386 of 5ysbA
Sites not aligning to the query:
4qsdA Crystal structure of atu4361 sugar transporter from agrobacterium fabrum c58, target efi-510558, with bound sucrose
26% identity, 63% coverage: 72:339/424 of query aligns to 41:306/382 of 4qsdA
Sites not aligning to the query:
4qrzA Crystal structure of sugar transporter atu4361 from agrobacterium fabrum c58, target efi-510558, with bound maltotriose
26% identity, 63% coverage: 72:339/424 of query aligns to 41:306/383 of 4qrzA
Sites not aligning to the query:
7x0lA Crystal structure of sugar binding protein cbpb complexed wtih cellotetraose from clostridium thermocellum (see paper)
27% identity, 73% coverage: 54:363/424 of query aligns to 26:336/409 of 7x0lA
Sites not aligning to the query:
3k02A Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
27% identity, 61% coverage: 33:292/424 of query aligns to 6:264/388 of 3k02A
Sites not aligning to the query:
3jzjA Crystal structures of the gach receptor of streptomyces glaucescens gla.O in the unliganded form and in complex with acarbose and an acarbose homolog. Comparison with acarbose-loaded maltose binding protein of salmonella typhimurium. (see paper)
27% identity, 61% coverage: 33:292/424 of query aligns to 6:264/388 of 3jzjA
Sites not aligning to the query:
4r9gA Cpmnbp1 with mannotriose bound (see paper)
27% identity, 66% coverage: 44:323/424 of query aligns to 19:303/394 of 4r9gA
Sites not aligning to the query:
4r9fA Cpmnbp1 with mannobiose bound (see paper)
28% identity, 69% coverage: 31:323/424 of query aligns to 1:311/402 of 4r9fA
Sites not aligning to the query:
6dtqA Maltose bound t. Maritima male3 (see paper)
25% identity, 70% coverage: 43:337/424 of query aligns to 14:312/391 of 6dtqA
Sites not aligning to the query:
6lceA Crystal structure of beta-l-arabinobiose binding protein - selenomethionine derivative (see paper)
26% identity, 78% coverage: 32:361/424 of query aligns to 16:346/407 of 6lceA
2z8fA The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with lacto-n- tetraose (see paper)
24% identity, 81% coverage: 44:388/424 of query aligns to 20:352/401 of 2z8fA
Sites not aligning to the query:
2z8dA The galacto-n-biose-/lacto-n-biose i-binding protein (gl-bp) of the abc transporter from bifidobacterium longum in complex with lacto-n- biose (see paper)
24% identity, 81% coverage: 44:388/424 of query aligns to 20:352/401 of 2z8dA
Sites not aligning to the query:
7vfqC Wild type glta from bifidobacterium infantis jcm 1222 complexed with lacto-n-tetraose
26% identity, 79% coverage: 52:388/424 of query aligns to 24:347/397 of 7vfqC
Sites not aligning to the query:
4ryaA Crystal structure of abc transporter solute binding protein avi_3567 from agrobacterium vitis s4, target efi-510645, with bound d-mannitol
26% identity, 55% coverage: 41:275/424 of query aligns to 11:246/417 of 4ryaA
Sites not aligning to the query:
>SM_b21652 FitnessBrowser__Smeli:SM_b21652
MDIQTRAYLPRIAGLALAGASFLGVTAAQAKEITIWCWDPNFNVAIMKEAGARYTKTHPD
VTFNIVDFAKLDVEQKLQTGLSSGTADALPDIVLIEDYGAQKYLQSFPGAFAPLSGTVDY
SGFAPYKVELMTLDGQVYGMPFDSGVTGLYYRKDYLEAAGFKPEDMQDLTWDRFIEIGKQ
VEEKTGKKMMGLDPNDAGLVRIIMQSAGQWYFDKEGKPNIAGNAALKAALETIGKIMQAN
IYKPANGWSDWVGTFTSGDVATVVTGVWITGTVKAQPDQSGNWGVAPIPALSIEGATHAS
NLGGSSWYVLESSEEKAEAIDFLNEIYAKDIDFYQKILQDRGAVGSLLAARGGAAYEAAD
PFFGGEKVWQNFSDWLAKVPSVNYGIFTNEADLAVTAQLPAVTQGTPVDEVLQAIEAEVS
AQIQ
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory