SitesBLAST
Comparing SMa0056 FitnessBrowser__Smeli:SMa0056 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4it1D Crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate
34% identity, 81% coverage: 9:314/377 of query aligns to 4:327/427 of 4it1D
- active site: S51 (≠ G53), D54 (≠ G56), A98 (vs. gap), Y150 (= Y136), K194 (= K174), K196 (= K176), D224 (= D204), N226 (= N206), Y247 (= Y228), E249 (= E230), T271 (= T252), N272 (= N253), M273 (≠ T254), D296 (= D277), H323 (= H310), S324 (≠ P311), N325 (≠ A312)
- binding magnesium ion: D224 (= D204), E249 (= E230), N272 (= N253)
Sites not aligning to the query:
3vc6A Crystal structure of enolase tbis_1083(target efi-502310) from thermobispora bispora dsm 43833 complexed with magnesium and formate
39% identity, 74% coverage: 6:283/377 of query aligns to 4:296/420 of 3vc6A
- active site: D52 (≠ G55), H55 (≠ S58), Y146 (= Y136), K188 (= K174), K190 (= K176), D218 (= D204), N220 (= N206), E243 (= E230), N266 (= N253), M267 (≠ T254), D290 (= D277)
- binding magnesium ion: D218 (= D204), E243 (= E230), N266 (= N253)
Sites not aligning to the query:
3va8A Crystal structure of enolase fg03645.1 (target efi-502278) from gibberella zeae ph-1 complexed with magnesium, formate and sulfate
32% identity, 95% coverage: 2:358/377 of query aligns to 9:373/427 of 3va8A
3pfrA Crystal structure of d-glucarate dehydratase related protein from actinobacillus succinogenes complexed with d-glucarate
33% identity, 74% coverage: 4:281/377 of query aligns to 3:297/426 of 3pfrA
- active site: K185 (= K174), K187 (= K176), D215 (= D204), N217 (= N206), E240 (= E230), N269 (= N253), D293 (= D277)
- binding d-glucarate: N22 (≠ H24), H27 (= H29), Y130 (= Y136), F132 (= F138), K187 (= K176), D215 (= D204), N217 (= N206), N269 (= N253)
- binding magnesium ion: D215 (= D204), E240 (= E230), N269 (= N253)
Sites not aligning to the query:
3n6hB Crystal structure of mandelate racemase/muconate lactonizing protein from actinobacillus succinogenes 130z complexed with magnesium/sulfate
33% identity, 74% coverage: 4:281/377 of query aligns to 4:301/432 of 3n6hB
Sites not aligning to the query:
1ecqA E. Coli glucarate dehydratase bound to 4-deoxyglucarate (see paper)
29% identity, 74% coverage: 4:281/377 of query aligns to 6:315/444 of 1ecqA
- active site: K203 (= K174), K205 (= K176), D233 (= D204), N235 (= N206), E258 (= E230), N287 (= N253), M288 (≠ T254), D311 (= D277)
- binding 4-deoxyglucarate: N25 (≠ H24), H30 (= H29), T101 (≠ L92), Y148 (= Y136), F150 (= F138), K205 (= K176), D233 (= D204), N235 (= N206), N287 (= N253)
- binding magnesium ion: D233 (= D204), E258 (= E230), N287 (= N253)
Sites not aligning to the query:
1ec9D E. Coli glucarate dehydratase bound to xylarohydroxamate (see paper)
29% identity, 74% coverage: 4:281/377 of query aligns to 6:315/444 of 1ec9D
- active site: K203 (= K174), K205 (= K176), D233 (= D204), N235 (= N206), E258 (= E230), N287 (= N253), M288 (≠ T254), D311 (= D277)
- binding magnesium ion: D233 (= D204), E258 (= E230), N287 (= N253)
- binding xylarohydroxamate: H30 (= H29), T101 (≠ L92), Y148 (= Y136), F150 (= F138), K205 (= K176), D233 (= D204), N235 (= N206), N287 (= N253)
Sites not aligning to the query:
1jctA Glucarate dehydratase, n341l mutant orthorhombic form (see paper)
29% identity, 74% coverage: 4:281/377 of query aligns to 5:314/443 of 1jctA
- active site: K202 (= K174), K204 (= K176), D232 (= D204), N234 (= N206), E257 (= E230), N286 (= N253), M287 (≠ T254), D310 (= D277)
- binding d-glucarate: N24 (≠ H24), H29 (= H29), T100 (≠ L92), Y147 (= Y136), F149 (= F138), K204 (= K176), D232 (= D204), N286 (= N253)
- binding magnesium ion: D232 (= D204), E257 (= E230), N286 (= N253)
Sites not aligning to the query:
1ec8A E. Coli glucarate dehydratase bound to product 2,3-dihydroxy-5-oxo- hexanedioate (see paper)
29% identity, 74% coverage: 4:281/377 of query aligns to 4:313/442 of 1ec8A
- active site: K201 (= K174), K203 (= K176), D231 (= D204), N233 (= N206), E256 (= E230), N285 (= N253), M286 (≠ T254), D309 (= D277)
- binding 2,3-dihydroxy-5-oxo-hexanedioate: N23 (≠ H24), H28 (= H29), T99 (≠ L92), Y146 (= Y136), K203 (= K176), D231 (= D204), N233 (= N206), N285 (= N253)
- binding magnesium ion: D231 (= D204), E256 (= E230), N285 (= N253)
Sites not aligning to the query:
P0AES2 Glucarate dehydratase; GDH; GlucD; D-glucarate dehydratase; EC 4.2.1.40 from Escherichia coli (strain K12) (see 3 papers)
29% identity, 74% coverage: 4:281/377 of query aligns to 8:317/446 of P0AES2
- Y150 (= Y136) mutation to F: Reduces activity 100-fold.
- K207 (= K176) active site, Proton acceptor; mutation to Q: Reduces activity 1000-fold.; mutation to R: Reduces activity 10000-fold.
- D235 (= D204) binding
- E266 (≠ L236) binding
- N289 (= N253) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 339 active site, Proton acceptor; H→A: Loss of activity.; H→N: Reduces activity 10000-fold.; H→Q: Reduces activity 1000-fold.
- 341 N→D: Inactive in the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.; N→L: Almost no effect on the dehydration reaction of D-glucarate, L-idarate, and 4F-Gluc.
- 366 mutation D->A,N: Reduces activity over 100-fold.
3p0wB Crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
30% identity, 74% coverage: 4:281/377 of query aligns to 3:301/428 of 3p0wB
- active site: K189 (= K174), K191 (= K176), D219 (= D204), N221 (= N206), E244 (= E230), N273 (= N253), D297 (= D277)
- binding d-glucarate: H27 (= H29), Y134 (= Y136), K191 (= K176), D219 (= D204), N221 (= N206), N273 (= N253)
- binding magnesium ion: D219 (= D204), E244 (= E230), N273 (= N253)
Sites not aligning to the query:
3nxlC Crystal structure of glucarate dehydratase from burkholderia cepacia complexed with magnesium
36% identity, 48% coverage: 102:281/377 of query aligns to 95:297/425 of 3nxlC
Sites not aligning to the query:
3nfuA Crystal structure of probable glucarate dehydratase from chromohalobacter salexigens dsm 3043 complexed with magnesium
26% identity, 74% coverage: 4:281/377 of query aligns to 3:313/441 of 3nfuA
- active site: K201 (= K174), K203 (= K176), D231 (= D204), N233 (= N206), E256 (= E230), N285 (= N253), D309 (= D277)
- binding magnesium ion: D231 (= D204), N233 (= N206), E256 (= E230), D257 (= D231), N285 (= N253)
Sites not aligning to the query:
4hpnA Crystal structure of a proposed galactarolactone cycloisomerase from agrobacterium tumefaciens, target efi-500704, with bound ca, ordered loops (see paper)
28% identity, 74% coverage: 5:283/377 of query aligns to 2:275/378 of 4hpnA
- active site: F19 (≠ L22), G50 (= G54), R53 (≠ E57), T134 (≠ Y136), K164 (= K174), K166 (= K176), D194 (= D204), N196 (= N206), E220 (= E230), G245 (≠ N253), E246 (≠ T254), T247 (≠ V255), Q267 (≠ L275), D269 (= D277)
- binding calcium ion: D194 (= D204), D209 (≠ K219), E220 (= E230), G237 (≠ N245), E246 (≠ T254)
Sites not aligning to the query:
2p8cA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl arg. (see paper)
28% identity, 66% coverage: 5:253/377 of query aligns to 2:243/369 of 2p8cA
- active site: F19 (≠ L22), A50 (≠ G54), H53 (vs. gap), V136 (≠ Y136), F160 (≠ H173), K161 (= K174), M162 (≠ L175), K163 (= K176), D191 (= D204), N193 (= N206), E218 (= E230), D243 (≠ N253)
- binding magnesium ion: D191 (= D204), E218 (= E230), D243 (≠ N253)
- binding n~2~-(3-carboxypropanoyl)-l-arginine: F19 (≠ L22), Y26 (≠ W30), M29 (≠ F33), D51 (≠ G55), K163 (= K176), D191 (= D204), D243 (≠ N253)
Sites not aligning to the query:
- active site: 244, 245, 265, 267, 294, 295, 296, 319, 320, 321
- binding n~2~-(3-carboxypropanoyl)-l-arginine: 267, 295, 296, 320, 321, 322
2p8bA Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 complexed with n-succinyl lys. (see paper)
28% identity, 66% coverage: 5:253/377 of query aligns to 2:243/369 of 2p8bA
- active site: F19 (≠ L22), A50 (≠ G54), H53 (vs. gap), V136 (≠ Y136), F160 (≠ H173), K161 (= K174), M162 (≠ L175), K163 (= K176), D191 (= D204), N193 (= N206), E218 (= E230), D243 (≠ N253)
- binding magnesium ion: D191 (= D204), E218 (= E230), D243 (≠ N253)
- binding n-succinyl lysine: F19 (≠ L22), Y26 (≠ W30), D51 (≠ G55), V136 (≠ Y136), K161 (= K174), K163 (= K176), D243 (≠ N253)
Sites not aligning to the query:
- active site: 244, 245, 265, 267, 294, 295, 296, 319, 320, 321
- binding n-succinyl lysine: 267, 295, 296, 320, 321, 322
2p88A Crystal structure of n-succinyl arg/lys racemase from bacillus cereus atcc 14579 (see paper)
28% identity, 66% coverage: 5:253/377 of query aligns to 2:243/369 of 2p88A
- active site: F19 (≠ L22), A50 (≠ G54), H53 (vs. gap), V136 (≠ Y136), F160 (≠ H173), K161 (= K174), M162 (≠ L175), K163 (= K176), D191 (= D204), N193 (= N206), E218 (= E230), D243 (≠ N253)
- binding magnesium ion: D191 (= D204), E218 (= E230), D243 (≠ N253)
Sites not aligning to the query:
Q81IL5 N-succinyl-L-Arg/Lys racemase; N-succinyl amino acid racemase; NSAR; EC 5.1.1.- from Bacillus cereus (strain ATCC 14579 / DSM 31 / CCUG 7414 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NCTC 2599 / NRRL B-3711) (see paper)
28% identity, 66% coverage: 5:253/377 of query aligns to 2:243/369 of Q81IL5
- D191 (= D204) binding
- E218 (= E230) binding
- D243 (≠ N253) binding
3sjnA Crystal structure of enolase spea_3858 (target efi-500646) from shewanella pealeana with magnesium bound
27% identity, 74% coverage: 5:283/377 of query aligns to 3:280/373 of 3sjnA
- active site: S46 (≠ G54), L49 (≠ E57), T139 (≠ S135), K165 (= K174), G167 (≠ K176), M171 (≠ F180), D198 (= D204), A200 (≠ N206), E225 (= E230), I247 (≠ L250), G250 (≠ N253), E251 (≠ T254), S252 (≠ V255), Q272 (≠ L275), D274 (= D277)
- binding magnesium ion: D198 (= D204), E225 (= E230), E251 (≠ T254)
Sites not aligning to the query:
4mggA Crystal structure of an enolase (mandelate racemase subgroup) from labrenzia aggregata iam 12614 (target nysgrc-012903) with bound mg, space group p212121
25% identity, 79% coverage: 5:300/377 of query aligns to 4:287/369 of 4mggA
- active site: Y22 (≠ L22), P54 (≠ G54), L97 (= L92), A140 (≠ Y136), Q165 (≠ K174), K167 (= K176), A194 (≠ Y203), D195 (= D204), A196 (≠ P205), N197 (= N206), Y218 (= Y228), E220 (= E230), Q221 (≠ D231), D243 (≠ N253), E244 (≠ T254), V245 (= V255), N265 (≠ L275), K267 (≠ D277)
- binding magnesium ion: D195 (= D204), E220 (= E230), D243 (≠ N253)
Sites not aligning to the query:
Query Sequence
>SMa0056 FitnessBrowser__Smeli:SMa0056
MKRPRITDIRATTVTVPLEAPLRHSNGAHWGRFVRTIVEVETDVGIVGLGEMGGGGESAE
AAFRALKPYLLGHDTFELENLRFMICNPTASLYNNRTQMHAAIEFACLDIMGKFLGVPVC
DLLGGKMRDAVPFASYMFFRLPNKDTGEGETRTADQLIEQTLALKKKCGFTSHKLKSGVF
PPDYELEVFRAWAKALGPDSVRYDPNAAFSVEEAIRFAKGIEDLNNDYYEDPTWGLNGMR
RVRENTTMPLATNTVVVNFEQLATNILNPAVDVILLDTTFWGGSALREGGGRLRDLPTRH
CGTFVGRTRHPARHHASPRRGSPEPRLPRGCALSPTHGRYHRRRPDALRERHYQGADGAG
SRGGARSRQARAVRRPP
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory