SitesBLAST
Comparing SMa0527 FitnessBrowser__Smeli:SMa0527 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1h2fA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with trivanadate (see paper)
31% identity, 96% coverage: 4:194/199 of query aligns to 4:198/207 of 1h2fA
- active site: R8 (= R8), H9 (= H9), N15 (= N15), R58 (= R58), E82 (= E79), H150 (= H144)
- binding phosphate ion: G142 (= G136), E143 (= E137)
- binding trivanadate: R8 (= R8), H9 (= H9), N15 (= N15), Q21 (= Q21), R58 (= R58), E82 (= E79), H150 (= H144), G151 (= G145), V152 (≠ G146)
Sites not aligning to the query:
1h2eA Bacillus stearothermophilus phoe (previously known as yhfr) in complex with phosphate (see paper)
31% identity, 96% coverage: 4:194/199 of query aligns to 4:198/207 of 1h2eA
P9WIC7 Glucosyl-3-phosphoglycerate phosphatase; Mannosyl-3-phosphoglycerate phosphatase; EC 3.1.3.85; EC 3.1.3.70 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see 2 papers)
37% identity, 57% coverage: 2:115/199 of query aligns to 4:121/223 of P9WIC7
- R10 (= R8) mutation to A: Loss of phosphatase activity.
- H11 (= H9) active site, Tele-phosphohistidine intermediate; mutation to A: Almost completely abolished phosphatase activity.
- N17 (= N15) mutation to A: About 5% of wild-type phosphatase activity.
- K47 (≠ A45) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
- R60 (= R58) mutation to A: Loss of phosphatase activity.
Sites not aligning to the query:
- 159 H→A: About 5% of wild-type phosphatase activity.
- 209 L→E: Disrupts dimerization of the enzyme, which exists as a monomer and has lost its ability to perform dephosphorylation.
4qihA The structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c complexes with vo3 (see paper)
37% identity, 57% coverage: 2:115/199 of query aligns to 2:119/209 of 4qihA
Sites not aligning to the query:
4pzaB The complex structure of mycobacterial glucosyl-3-phosphoglycerate phosphatase rv2419c with inorganic phosphate (see paper)
37% identity, 57% coverage: 2:115/199 of query aligns to 3:120/217 of 4pzaB
Sites not aligning to the query:
6m1xC Crystal structure of phosphoserine phosphatase in complex with 3- phosphoglyceric acid from entamoeba histolytica (see paper)
28% identity, 94% coverage: 1:187/199 of query aligns to 1:191/196 of 6m1xC
1k6mA Crystal structure of human liver 6-phosphofructo-2-kinase/fructose-2, 6-bisphosphatase (see paper)
34% identity, 78% coverage: 2:156/199 of query aligns to 213:366/432 of 1k6mA
Sites not aligning to the query:
- binding phosphothiophosphoric acid-adenylate ester: 13, 14, 15, 16, 17, 18, 92, 120, 131, 134, 135, 136, 184, 210
1tipA The bisphosphatase domain of the bifunctional rat liver 6- phosphofructo-2-kinase/fructose-2,6-bisphosphatase (see paper)
32% identity, 95% coverage: 1:189/199 of query aligns to 1:190/191 of 1tipA
- active site: R8 (= R8), H9 (= H9), N15 (= N15), R58 (= R58), E78 (= E79), H143 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: I20 (≠ L20), Y89 (≠ G87), R103 (vs. gap), K107 (≠ A100), Y118 (≠ W117), R148 (= R149)
1c81A Michaelis complex of fructose-2,6-bisphosphatase
32% identity, 95% coverage: 1:189/199 of query aligns to 1:190/191 of 1c81A
- active site: R8 (= R8), H9 (= H9), N15 (= N15), R58 (= R58), E78 (= E79), H143 (= H144)
- binding 2,5-anhydro-1-deoxy-1-phosphono-6-O-phosphono-D-glucitol: R8 (= R8), H9 (= H9), N15 (= N15), I20 (≠ L20), R58 (= R58), E78 (= E79), H143 (= H144), Q144 (≠ G145), R148 (= R149)
1c80A Regulatory complex of fructose-2,6-bisphosphatase
32% identity, 95% coverage: 1:189/199 of query aligns to 1:190/191 of 1c80A
- active site: R8 (= R8), H9 (= H9), N15 (= N15), R58 (= R58), E78 (= E79), H143 (= H144)
- binding guanosine-5'-triphosphate: I20 (≠ L20), E78 (= E79), I79 (= I80), Y89 (≠ G87), F100 (vs. gap), R103 (vs. gap), Y112 (≠ P111), Y118 (≠ W117), Q144 (≠ G145), A145 (≠ G146), R148 (= R149)
1c7zA Regulatory complex of fructose-2,6-bisphosphatase
32% identity, 95% coverage: 1:189/199 of query aligns to 1:190/191 of 1c7zA
- active site: R8 (= R8), H9 (= H9), N15 (= N15), R58 (= R58), E78 (= E79), H143 (= H144)
- binding glyceraldehyde-3-phosphate: Y89 (≠ G87), R103 (vs. gap), K107 (≠ A100), Y118 (≠ W117), Q144 (≠ G145), A145 (≠ G146), R148 (= R149)
5zr2C Crystal structure of phosphoserine phosphatase mutant (h9a) from entamoeba histolytica in complex with phosphoserine (see paper)
28% identity, 94% coverage: 1:187/199 of query aligns to 1:191/198 of 5zr2C
O60825 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2; 6PF-2-K/Fru-2,6-P2ase 2; PFK/FBPase 2; 6PF-2-K/Fru-2,6-P2ase heart-type isozyme; EC 2.7.1.105; EC 3.1.3.46 from Homo sapiens (Human) (see 2 papers)
34% identity, 77% coverage: 4:156/199 of query aligns to 252:403/505 of O60825
Sites not aligning to the query:
- 466 modified: Phosphoserine; by AMPK; S→E: Constitutively active mutant that cannot be phosphorylated and further activated by AMPK.
- 468 modified: Phosphothreonine
- 483 modified: Phosphoserine; by BRAF
- 486 modified: Phosphoserine
- 493 modified: Phosphoserine
5htkA Human heart 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase (pfkfb2) (see paper)
34% identity, 78% coverage: 2:156/199 of query aligns to 220:373/425 of 5htkA
- active site: R226 (= R8), H227 (= H9), N233 (= N15), R276 (= R58), E296 (= E79), H361 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: H227 (= H9), I238 (≠ L20), G239 (≠ Q21), E296 (= E79), Y307 (vs. gap), R321 (≠ E96), K325 (≠ A100), Y336 (≠ W117), Q362 (≠ G145), R366 (= R149)
Sites not aligning to the query:
- binding adenosine-5'-triphosphate: 17, 18, 19, 20, 21, 22, 140, 144, 145, 146, 397, 398
- binding citrate anion: 48, 61, 72, 99, 100, 167
5ak0A Human pfkfb3 in complex with an indole inhibitor 6 (see paper)
31% identity, 96% coverage: 2:192/199 of query aligns to 243:434/442 of 5ak0A
- active site: R249 (= R8), H250 (= H9), N256 (= N15), S299 (≠ R58), E319 (= E79), H384 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: G262 (vs. gap), E319 (= E79), Y330 (≠ G87), R344 (vs. gap), K348 (≠ A100), Y359 (≠ W117), Q385 (≠ G145), R389 (= R149)
- binding phosphonic acid: R249 (= R8), H250 (= H9), H384 (= H144), Q385 (≠ G145)
Sites not aligning to the query:
- binding (2s)-n-[4-[1-methyl-3-(1-methylpyrazol-4-yl)indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 46, 47, 149, 159, 161, 214, 215, 218, 235, 236, 238
4d4lA Human pfkfb3 in complex with a pyrrolopyrimidone compound
31% identity, 96% coverage: 2:192/199 of query aligns to 243:434/442 of 4d4lA
- active site: R249 (= R8), H250 (= H9), N256 (= N15), S299 (≠ R58), E319 (= E79), H384 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ A24), G262 (vs. gap), E319 (= E79), Y330 (≠ G87), R344 (vs. gap), K348 (≠ A100), Y359 (≠ W117), Q385 (≠ G145), R389 (= R149)
- binding phosphonic acid: R249 (= R8), H250 (= H9), N256 (= N15), H384 (= H144), Q385 (≠ G145)
Sites not aligning to the query:
- binding 5-(4-chlorophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 240
- binding 6-O-phosphono-beta-D-fructofuranose: 437
4d4jA Human pfkfb3 in complex with a pyrrolopyrimidone compound
31% identity, 96% coverage: 2:192/199 of query aligns to 243:434/442 of 4d4jA
- active site: R249 (= R8), H250 (= H9), N256 (= N15), S299 (≠ R58), E319 (= E79), H384 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ A24), G262 (vs. gap), E319 (= E79), Y330 (≠ G87), R344 (vs. gap), K348 (≠ A100), Y359 (≠ W117), Q385 (≠ G145), R389 (= R149)
- binding phosphonic acid: R249 (= R8), H250 (= H9), E319 (= E79), H384 (= H144), Q385 (≠ G145)
Sites not aligning to the query:
- binding 5-(4-bromophenyl)-7-phenyl-3,7-dihydro-4H-pyrrolo[2,3-d]pyrimidin-4-one: 42, 43, 46, 47, 156, 160, 163, 211, 214, 235, 238, 240
5ajxA Human pfkfb3 in complex with an indole inhibitor 3 (see paper)
31% identity, 96% coverage: 2:192/199 of query aligns to 243:434/441 of 5ajxA
- active site: R249 (= R8), H250 (= H9), N256 (= N15), S299 (≠ R58), E319 (= E79), H384 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: I261 (≠ A24), G262 (vs. gap), E319 (= E79), Y330 (≠ G87), R344 (vs. gap), K348 (≠ A100), Y359 (≠ W117), Q385 (≠ G145), R389 (= R149)
- binding phosphonic acid: R249 (= R8), H250 (= H9), N256 (= N15), H384 (= H144), Q385 (≠ G145)
Sites not aligning to the query:
- binding (2S)-N-[4-[3-cyano-1-[(3,5-dimethyl-1,2-oxazol-4-yl)methyl]indol-5-yl]oxyphenyl]pyrrolidine-2-carboxamide: 42, 43, 46, 47, 211, 214, 215, 218, 235, 236, 238, 240
6hviA Human pfkfb3 in complex with a n-aryl 6-aminoquinoxaline inhibitor 2 (see paper)
31% identity, 96% coverage: 2:192/199 of query aligns to 233:424/433 of 6hviA
- active site: R239 (= R8), H240 (= H9), N246 (= N15), S289 (≠ R58), E309 (= E79), H374 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: G252 (vs. gap), E309 (= E79), Y320 (≠ G87), R334 (vs. gap), K338 (≠ A100), Y349 (≠ W117), Q375 (≠ G145), R379 (= R149)
- binding pyrophosphate 2-: Y411 (≠ G179)
Sites not aligning to the query:
- binding 8-[3-(dimethylamino)phenyl]-~{N}-(4-methylsulfonylpyridin-3-yl)quinoxalin-6-amine: 32, 33, 36, 37, 139, 141, 146, 150, 153, 201, 204, 228, 230
- binding pyrophosphate 2-: 31, 32, 33, 34, 35, 36, 155
5ajwA Human pfkfb3 in complex with an indole inhibitor 2 (see paper)
31% identity, 96% coverage: 2:192/199 of query aligns to 240:431/439 of 5ajwA
- active site: R246 (= R8), H247 (= H9), N253 (= N15), S296 (≠ R58), E316 (= E79), H381 (= H144)
- binding 6-O-phosphono-beta-D-fructofuranose: G259 (vs. gap), E316 (= E79), Y327 (≠ G87), R341 (vs. gap), K345 (≠ A100), Y356 (≠ W117), Q382 (≠ G145), R386 (= R149)
- binding phosphonic acid: R246 (= R8), H247 (= H9), N253 (= N15), H381 (= H144), Q382 (≠ G145)
Sites not aligning to the query:
- binding 2-amino-N-[4-(2-amino-1-benzyl-3-cyano-indol-5-yl)oxyphenyl]acetamide: 39, 40, 43, 44, 153, 157, 208, 211, 212, 215, 232, 233, 235, 237
Query Sequence
>SMa0527 FitnessBrowser__Smeli:SMa0527
MKRIILVRHGESAWNSVRRLQGQADIGLSARGEAQATALRATIEAMRPDHVIASDLLRAR
HTAALLGYPHAQLSPALREIDVGDWTGRAIGDLMAEDQDAYLGWRAGTYAPRGGERWQEF
RDRVTAGLGKAVSIPGERLLVVCHGGVIRALLDGLLGLPPKRIIPVGPASVTVLADKPGG
MRLETFNFSPDGPVFDAPD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory