Comparing SMa0564 FitnessBrowser__Smeli:SMa0564 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 17 hits to proteins with known functional sites (download)
3a9hA Crystal structure of pqq-dependent sugar dehydrogenase holo-form (see paper)
36% identity, 87% coverage: 48:366/367 of query aligns to 1:336/338 of 3a9hA
3a9gA Crystal structure of pqq-dependent sugar dehydrogenase apo-form (see paper)
36% identity, 87% coverage: 48:366/367 of query aligns to 1:336/338 of 3a9gA
3dasA Structure of the pqq-bound form of aldose sugar dehydrogenase (adh) from streptomyces coelicolor
37% identity, 85% coverage: 55:366/367 of query aligns to 13:334/334 of 3dasA
2ismB Crystal structure of the putative oxidoreductase (glucose dehydrogenase) (ttha0570) from thermus theromophilus hb8
39% identity, 83% coverage: 59:363/367 of query aligns to 10:332/333 of 2ismB
1cq1A Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqqh2 and glucose (see paper)
34% identity, 56% coverage: 71:276/367 of query aligns to 38:270/444 of 1cq1A
Sites not aligning to the query:
1c9uA Crystal structure of the soluble quinoprotein glucose dehydrogenase in complex with pqq (see paper)
34% identity, 56% coverage: 71:276/367 of query aligns to 38:270/444 of 1c9uA
Sites not aligning to the query:
P13650 Quinoprotein glucose dehydrogenase B; Glucose dehydrogenase B [pyrroloquinoline-quinone]; Soluble glucose dehydrogenase; s-GDH; EC 1.1.5.2 from Acinetobacter calcoaceticus (see paper)
34% identity, 56% coverage: 71:276/367 of query aligns to 62:300/478 of P13650
Sites not aligning to the query:
1cruA Soluble quinoprotein glucose dehydrogenase from acinetobacter calcoaceticus in complex with pqq and methylhydrazine (see paper)
34% identity, 56% coverage: 71:276/367 of query aligns to 38:274/448 of 1cruA
Sites not aligning to the query:
5minB Apo form of the soluble pqq-dependent glucose dehydrogenase from acinetobacter calcoaceticus
34% identity, 56% coverage: 71:276/367 of query aligns to 38:276/453 of 5minB
Sites not aligning to the query:
P75804 Aldose sugar dehydrogenase YliI; Asd; Soluble aldose sugar dehydrogenase YliI; EC 1.1.5.- from Escherichia coli (strain K12) (see paper)
29% identity, 89% coverage: 23:349/367 of query aligns to 7:360/371 of P75804
2g8sA Crystal structure of the soluble aldose sugar dehydrogenase (asd) from escherichia coli in the apo-form (see paper)
30% identity, 81% coverage: 54:349/367 of query aligns to 6:338/348 of 2g8sA
7cdyA Crystal structure of glucose dehydrogenase
33% identity, 59% coverage: 54:269/367 of query aligns to 4:232/346 of 7cdyA
7cgzA Glucose dehydrogenase
30% identity, 80% coverage: 54:347/367 of query aligns to 4:309/321 of 7cgzA
7pgnB Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
25% identity, 55% coverage: 56:256/367 of query aligns to 9:222/438 of 7pgnB
Sites not aligning to the query:
7pgnA Hhp-c in complex with glycosaminoglycan mimic sos (see paper)
25% identity, 55% coverage: 56:256/367 of query aligns to 10:223/437 of 7pgnA
Sites not aligning to the query:
2wfxB Crystal structure of the complex between human hedgehog-interacting protein hip and sonic hedgehog in the presence of calcium (see paper)
23% identity, 55% coverage: 50:252/367 of query aligns to 2:213/417 of 2wfxB
Sites not aligning to the query:
7pgmB Hhip-c in complex with heparin (see paper)
25% identity, 57% coverage: 48:256/367 of query aligns to 1:218/427 of 7pgmB
Sites not aligning to the query:
>SMa0564 FitnessBrowser__Smeli:SMa0564
MPILPEKRRTRMRKRLICTTLSILVGGCCLSGTSMAQDASTPILDRGEGAWSSSVLADGL
DYPWDIVRDGERLILTEKAGTVVIIEGGNVQRSTLQTSDPLRTEGGAGLLGIALAPDFAD
SGQAFFYYSYSSGSEPANRIVAARFDGNTWRETAVLVDAIPGHRLYNGGRIAIGPDDHLY
VTTGWTENYERPQDLQSLAGKVLRLTLAGGVPEDNPFQGSLVYSFGHRNPQGLAWNAEGE
LFVSEHGQAALDEINLIAPGANYGWPIISGDETQEGMQPPFVHSGGDTWAPSGIAFAGNE
LLVTALQGRGLYVLDRQARTLQPVVSLGERVRHVLPVGDDLLLITTNRSPRGQGPSKDRL
VRLSAQN
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory