Comparing SMa1403 FitnessBrowser__Smeli:SMa1403 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
28% identity, 90% coverage: 5:309/338 of query aligns to 3:279/315 of 7svqA
7ezlA Rice l-galactose dehydrogenase (holo form)
26% identity, 91% coverage: 2:310/338 of query aligns to 1:281/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
26% identity, 95% coverage: 5:324/338 of query aligns to 9:300/323 of 7eziA
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
28% identity, 91% coverage: 5:310/338 of query aligns to 3:269/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
28% identity, 91% coverage: 5:310/338 of query aligns to 3:269/298 of 1ynpB
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
26% identity, 91% coverage: 5:310/338 of query aligns to 1:290/311 of 1pz0A
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
26% identity, 91% coverage: 5:310/338 of query aligns to 2:291/310 of P46336
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
27% identity, 91% coverage: 5:310/338 of query aligns to 3:254/283 of 1ynpA
Sites not aligning to the query:
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
24% identity, 91% coverage: 5:310/338 of query aligns to 2:303/326 of P77256
8hw0A The structure of akr6d1
24% identity, 92% coverage: 5:314/338 of query aligns to 2:303/329 of 8hw0A
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
24% identity, 89% coverage: 8:309/338 of query aligns to 5:290/337 of Q3L181
3v0sA Crystal structure of perakine reductase, founder member of a novel akr subfamily with unique conformational changes during NADPH binding (see paper)
23% identity, 89% coverage: 8:309/338 of query aligns to 5:258/287 of 3v0sA
5danA Crystal structure of a novel aldo keto reductase tm1743 from thermotoga maritima in complex with NADP+
24% identity, 90% coverage: 7:310/338 of query aligns to 4:256/274 of 5danA
6kiyA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor epalrestat (see paper)
24% identity, 90% coverage: 7:310/338 of query aligns to 5:257/275 of 6kiyA
6kikA Crystal structure of a thermostable aldo-keto reductase tm1743 in complex with inhibitor tolrestat (see paper)
24% identity, 90% coverage: 7:310/338 of query aligns to 5:257/275 of 6kikA
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
26% identity, 90% coverage: 2:305/338 of query aligns to 10:284/312 of 3erpA
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
26% identity, 90% coverage: 2:305/338 of query aligns to 11:289/315 of 5t79A
4exaF Crystal structure of the pa4992, the putative aldo-keto reductase from pseudomona aeruginosa (see paper)
30% identity, 61% coverage: 7:213/338 of query aligns to 14:192/259 of 4exaF
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 90% coverage: 5:308/338 of query aligns to 2:296/323 of 6ow0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 90% coverage: 5:308/338 of query aligns to 2:272/301 of 6ow0B
>SMa1403 FitnessBrowser__Smeli:SMa1403
MHPGEKRKFGRVDLDVTAFGFGTAPLGNIFREIDEETSQSMFELAWDAGVRFFDTAPMYG
HGLAELRTGQGLRWRDRDEYVLSSKVGRLLTPAKRSTIDFAPWVNAAPFSMRFDYSYDGT
MRSFEDSLQRLGLERMDICFIHDIDVFTRGSEQPEVFGQAMDGTWRALEKLRSEGLVKAI
GVGVNEWEVCHEALKQRDFDCFLLAGRYTLLEQDALEEFLPLCEERGAAVVVGGGFNSGI
LATGAREGAKYNYAPAPKAILEKVARIEAVCRTHDVPLGAAALQFVVAHPAVPSFMAGTR
TIEQLRQNLSWFSHPIPAGFWTELKSKGLLREDAPIPA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory