SitesBLAST
Comparing SMc00375 FitnessBrowser__Smeli:SMc00375 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
3rc1A Crystal structure of kijd10, a 3-ketoreductase from actinomadura kijaniata incomplex with NADP and tdp-benzene (see paper)
31% identity, 99% coverage: 2:327/328 of query aligns to 3:325/325 of 3rc1A
- active site: K95 (= K95), Y179 (= Y179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: C10 (≠ T9), A11 (= A10), D12 (≠ K11), I13 (= I12), S35 (= S34), R36 (= R35), Y56 (= Y56), P71 (= P71), L72 (= L72), P73 (= P73), H77 (= H77), E94 (= E94), K95 (= K95), I162 (≠ M162), R163 (= R163), V168 (≠ L168), D175 (= D175), Y179 (= Y179)
- binding phosphate ion: H278 (≠ Q277), K283 (≠ L284)
- binding 5'-O-[(S)-hydroxy{[(S)-hydroxy(phenoxy)phosphoryl]oxy}phosphoryl]thymidine: R16 (≠ E15), R17 (≠ L16), F152 (= F152), I154 (≠ Y154), P155 (≠ Y155), Y233 (≠ A232), T253 (≠ N252)
B3TMR8 dTDP-3,4-didehydro-2,6-dideoxy-alpha-D-glucose 3-reductase; 3-ketoreductase; NADPH-dependent C3-ketoreductase; EC 1.1.1.384 from Actinomadura kijaniata (see paper)
31% identity, 99% coverage: 2:327/328 of query aligns to 10:332/332 of B3TMR8
- 17:23 (vs. 9:15, 29% identical) binding
- SR 42:43 (= SR 34:35) binding
- Y63 (= Y56) binding
- L79 (= L72) binding
- H84 (= H77) binding
- K102 (= K95) active site, Proton donor; mutation K->A,M,Q: Loss of reductase activity.; mutation to E: Retains some activity, but the catalytic efficiency is strongly reduced.
- R170 (= R163) binding
- D182 (= D175) binding
- Y186 (= Y179) mutation to F: Same affinity for dTDP-glucose and NADPH compared to the wild-type. Small reduction of the catalytic efficiency resulting from the conformational flexibility of the nicotinamide ring.
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
34% identity, 62% coverage: 3:204/328 of query aligns to 33:244/383 of 1h6dA
- active site: K131 (= K95), Y219 (= Y179)
- binding glycerol: K131 (= K95), R202 (vs. gap), D215 (= D175), Y219 (= Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (≠ S8), L41 (≠ T9), G42 (≠ A10), K43 (= K11), Y44 (≠ I12), S66 (= S34), G67 (≠ R35), K71 (= K39), Y89 (≠ F53), I107 (≠ P71), L108 (= L72), P109 (= P73), N110 (≠ T74), H113 (= H77), E130 (= E94), K131 (= K95), R159 (≠ M123), A198 (≠ S167), W201 (vs. gap), R202 (vs. gap), Y219 (= Y179)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
34% identity, 62% coverage: 3:204/328 of query aligns to 31:242/381 of 1rydA
- active site: K129 (= K95), Y217 (= Y179)
- binding alpha-D-glucopyranose: Y236 (≠ N198)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ T9), G40 (≠ A10), K41 (= K11), Y42 (≠ I12), S64 (= S34), G65 (≠ R35), K69 (= K39), Y87 (≠ F53), L106 (= L72), P107 (= P73), N108 (≠ T74), L110 (≠ Q76), H111 (= H77), E128 (= E94), K129 (= K95), R157 (≠ M123), A196 (≠ S167), W199 (vs. gap), R200 (vs. gap), Y217 (= Y179)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
34% identity, 61% coverage: 3:203/328 of query aligns to 2:212/340 of 1evjA
- active site: K100 (= K95), Y188 (= Y179)
- binding nicotinamide-adenine-dinucleotide: G9 (≠ S8), L10 (≠ T9), G11 (≠ A10), K12 (= K11), Y13 (≠ I12), D35 (≠ S34), L77 (= L72), P78 (= P73), N79 (≠ T74), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ M123), W170 (vs. gap), R171 (vs. gap), Y188 (= Y179)
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
31% identity, 76% coverage: 2:250/328 of query aligns to 2:251/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
31% identity, 76% coverage: 2:250/328 of query aligns to 2:251/331 of 2o4uX
- binding phosphate ion: L2 (= L2), S8 (= S8), V9 (≠ T9), A35 (≠ S34), R36 (= R35), R40 (≠ K39), Y57 (= Y56), N101 (≠ K100), A103 (≠ E102), D145 (≠ R144), R147 (= R146), K155 (≠ Y154), Q232 (≠ A231), S234 (≠ R233), T236 (≠ V235), Q247 (≠ E246), N250 (≠ S249)
Sites not aligning to the query:
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
31% identity, 76% coverage: 2:250/328 of query aligns to 3:252/334 of Q7JK39
- H79 (= H77) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (= Y179) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
31% identity, 76% coverage: 2:250/328 of query aligns to 3:252/334 of Q9TQS6
- R148 (= R146) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
- R202 (≠ E200) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
5a06A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with sorbitol (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 4:330/336 of 5a06A
- active site: K101 (= K95), Y186 (= Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L11 (≠ T9), G12 (≠ A10), Y13 (≠ K11), Y14 (≠ I12), S36 (= S34), G37 (≠ R35), T38 (≠ D36), K41 (= K39), Y59 (≠ F53), I77 (≠ P71), T78 (≠ L72), P79 (= P73), N80 (≠ T74), L82 (≠ Q76), H83 (= H77), E100 (= E94), K101 (= K95), R129 (≠ M123), W168 (≠ M162), R169 (= R163), Y186 (= Y179), Y264 (≠ N267)
- binding sorbitol: D72 (= D66), H96 (= H90), K101 (= K95), R122 (≠ V116), R122 (≠ V116), L124 (≠ I118), F160 (≠ Y154), R169 (= R163), D182 (= D175), Y186 (= Y179), K287 (≠ A279), H296 (≠ A288), E299 (≠ R291), E306 (= E298), G310 (≠ T302), G311 (≠ L303)
Sites not aligning to the query:
5a03C Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 4:330/336 of 5a03C
- active site: K101 (= K95), Y186 (= Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G10 (≠ S8), L11 (≠ T9), G12 (≠ A10), Y13 (≠ K11), Y14 (≠ I12), S36 (= S34), G37 (≠ R35), T38 (≠ D36), K41 (= K39), Y59 (≠ F53), I77 (≠ P71), T78 (≠ L72), P79 (= P73), N80 (≠ T74), L82 (≠ Q76), H83 (= H77), E100 (= E94), K101 (= K95), R129 (≠ M123), W168 (≠ M162), R169 (= R163), Y186 (= Y179), Y264 (≠ N267)
- binding beta-D-xylopyranose: K101 (= K95), F160 (≠ Y154), R169 (= R163), D182 (= D175), Y186 (= Y179)
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 3:329/335 of 5a05A
- active site: K100 (= K95), Y185 (= Y179)
- binding beta-D-glucopyranose: K100 (= K95), F159 (≠ Y154), D181 (= D175), Y185 (= Y179)
- binding alpha-D-glucopyranose: P259 (≠ L263), S262 (≠ Q266)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (≠ S8), L10 (≠ T9), G11 (≠ A10), Y12 (≠ K11), Y13 (≠ I12), S35 (= S34), G36 (≠ R35), T37 (≠ D36), K40 (= K39), Y58 (≠ F53), I76 (≠ P71), T77 (≠ L72), P78 (= P73), N79 (≠ T74), L81 (≠ Q76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ M123), W167 (≠ M162), R168 (= R163), Y185 (= Y179), Y263 (≠ N267)
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 3:329/335 of 5a04A
- active site: K100 (= K95), Y185 (= Y179)
- binding beta-D-glucopyranose: K100 (= K95), F159 (≠ Y154), R168 (= R163), D181 (= D175), Y185 (= Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T9), G11 (≠ A10), Y12 (≠ K11), Y13 (≠ I12), S35 (= S34), G36 (≠ R35), T37 (≠ D36), K40 (= K39), Y58 (≠ F53), I76 (≠ P71), T77 (≠ L72), P78 (= P73), N79 (≠ T74), L81 (≠ Q76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ M123), W167 (≠ M162), R168 (= R163), Y185 (= Y179), Y263 (≠ N267)
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 3:329/335 of 5a03E
- active site: K100 (= K95), Y185 (= Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (≠ S8), L10 (≠ T9), G11 (≠ A10), Y12 (≠ K11), Y13 (≠ I12), S35 (= S34), G36 (≠ R35), T37 (≠ D36), K40 (= K39), Y58 (≠ F53), I76 (≠ P71), T77 (≠ L72), P78 (= P73), N79 (≠ T74), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ M123), W167 (≠ M162), R168 (= R163), Y185 (= Y179), Y263 (≠ N267)
- binding beta-D-xylopyranose: K100 (= K95), F159 (≠ Y154), R168 (= R163), D181 (= D175), Y185 (= Y179), E205 (vs. gap), T207 (= T199), R209 (= R201)
- binding alpha-D-xylopyranose: H134 (≠ V129), M268 (≠ Q272), R279 (vs. gap), E280 (vs. gap)
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
25% identity, 98% coverage: 2:322/328 of query aligns to 3:329/335 of 5a02A
- active site: K100 (= K95), Y185 (= Y179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ T9), G11 (≠ A10), Y12 (≠ K11), Y13 (≠ I12), S35 (= S34), G36 (≠ R35), T37 (≠ D36), K40 (= K39), Y58 (≠ F53), I76 (≠ P71), T77 (≠ L72), P78 (= P73), L81 (≠ Q76), H82 (= H77), E99 (= E94), K100 (= K95), R128 (≠ M123), W167 (≠ M162), R168 (= R163), Y185 (= Y179), Y263 (≠ N267)
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
27% identity, 97% coverage: 2:320/328 of query aligns to 4:315/325 of 1zh8A
- active site: K98 (= K95), H187 (≠ Y179)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (≠ S8), C11 (≠ T9), G12 (≠ A10), I13 (≠ K11), A14 (≠ I12), S37 (= S34), R38 (= R35), T39 (≠ D36), H42 (≠ K39), T74 (≠ P71), L75 (= L72), P76 (= P73), L79 (≠ Q76), E97 (= E94), K98 (= K95), N126 (≠ M123), Y165 (vs. gap), W170 (≠ M162), R171 (= R163), H187 (≠ Y179), Y276 (≠ G269)
Q2I8V6 1,5-anhydro-D-fructose reductase; Anhydrofructose reductase; 1,5-anhydro-D-fructose reductase (1,5-anhydro-D-mannitol-forming); EC 1.1.1.292 from Ensifer adhaerens (Sinorhizobium morelense) (see paper)
30% identity, 93% coverage: 1:306/328 of query aligns to 1:307/333 of Q2I8V6
- ASTI 9:12 (≠ TAKI 9:12) binding
- S10 (≠ A10) mutation to G: Almost no effect.
- A13 (≠ G13) mutation to G: Can use NAD as cosubstrate as well as NADP.
- S33 (= S34) mutation to D: No activity.
- ST 33:34 (≠ SR 34:35) binding
- R38 (≠ K39) binding
- TTNELH 71:76 (≠ LPTSQH 72:77) binding
- EK 93:94 (= EK 94:95) binding
- K94 (= K95) mutation to G: Less than 1% remaining activity.
- N120 (≠ E120) binding
- WR 162:163 (≠ NM 161:162) binding
- D176 (= D175) mutation to A: Less than 1% remaining activity.
- H180 (≠ Y179) mutation to A: Less than 2% remaining activity.
- G206 (vs. gap) mutation to I: No effect.
- Y283 (= Y282) binding
2glxA Crystal structure analysis of bacterial 1,5-af reductase (see paper)
30% identity, 93% coverage: 3:306/328 of query aligns to 2:306/332 of 2glxA
- active site: K93 (= K95), H179 (≠ Y179)
- binding acetate ion: K93 (= K95), H179 (≠ Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G7 (≠ S8), A8 (≠ T9), S9 (≠ A10), T10 (≠ K11), I11 (= I12), S32 (= S34), T33 (≠ R35), R37 (≠ K39), S69 (≠ P71), T70 (≠ L72), N72 (≠ T74), H75 (= H77), E92 (= E94), K93 (= K95), H121 (≠ Y122), W161 (≠ N161), R162 (≠ M162), Y282 (= Y282)
4koaA Crystal structure analysis of 1,5-anhydro-d-fructose reductase from sinorhizobium meliloti (see paper)
34% identity, 60% coverage: 1:197/328 of query aligns to 1:198/333 of 4koaA
- active site: K94 (= K95), H180 (≠ Y179)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G8 (≠ S8), A9 (≠ T9), S10 (≠ A10), T11 (≠ K11), I12 (= I12), S33 (≠ A33), S34 (= S34), R38 (≠ K39), T71 (≠ L72), N73 (≠ T74), H76 (= H77), K94 (= K95), Q160 (≠ P159)
3e18A Crystal structure of NAD-binding protein from listeria innocua
34% identity, 39% coverage: 53:179/328 of query aligns to 52:178/348 of 3e18A
- active site: K94 (= K95), H178 (≠ Y179)
- binding nicotinamide-adenine-dinucleotide: A70 (≠ P71), T71 (≠ L72), P72 (= P73), N73 (≠ T74), H76 (= H77), E93 (= E94), K94 (= K95), N122 (≠ S127), W161 (≠ M162), R162 (= R163), H178 (≠ Y179)
Sites not aligning to the query:
Query Sequence
>SMc00375 FitnessBrowser__Smeli:SMc00375
MLRFGILSTAKIGRELVVPAIQDAENCVVTAIASRDLAKARAMADRFSVPHAFGSYEEML
ASDTVDAVYIPLPTSQHVEWAIKAADAGKHVLCEKPLALKAEEIDAVIAARERNKVLISE
AYMVTYSPVWRKVRSLIAEGAIGRLRHVQGAFTYYNRDPGNMRNVPSLGGGGLPDIGVYP
AITTRFSTGKEPLRVQANTERDPEFGTDVYSSVRADFGDFELSFYISTQLAARQVMVFHG
DKGYIEVKSPFNADRYGREEVELTNQNHGQSQLFRFQDARQYKLEAEAFARAAKGEAEDV
VTLENSRLNQMFIDAIYRASEKDGWEPV
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory