SitesBLAST
Comparing SMc00588 FitnessBrowser__Smeli:SMc00588 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
Q53TZ2 L-arabinose 1-dehydrogenase (NAD(P)(+)); D-galactose 1-dehydrogenase; EC 1.1.1.376; EC 1.1.1.120; EC 1.1.1.48 from Azospirillum brasilense (see paper)
55% identity, 98% coverage: 4:306/308 of query aligns to 5:307/309 of Q53TZ2
- D169 (= D168) mutation to A: Loss of activity.
- N173 (= N172) mutation to A: Decrease by 4 orders of magnitude in catalytic efficiency.
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
7cgqA Crystal structure of azospirillum brasilense l-arabinose 1- dehydrogenase e147a mutant (NADP and l-arabinose bound form)
55% identity, 98% coverage: 4:306/308 of query aligns to 2:304/306 of 7cgqA
- binding alpha-L-arabinopyranose: K88 (= K90), H116 (= H118), H150 (= H152), P167 (= P169), N170 (= N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G12), K11 (= K13), I12 (= I14), S34 (= S36), R35 (= R37), H36 (= H38), C64 (= C66), A65 (≠ M67), P66 (= P68), V69 (≠ Y71), E87 (= E89), K88 (= K90), H116 (= H118), Q153 (= Q155), W155 (= W157), D166 (= D168), Y263 (= Y265)
3m2tA The crystal structure of dehydrogenase from chromobacterium violaceum
34% identity, 33% coverage: 1:102/308 of query aligns to 1:109/342 of 3m2tA
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), A13 (≠ K13), Q14 (≠ I14), D36 (≠ S36), S37 (≠ R37), R41 (vs. gap), A73 (≠ C66), G74 (≠ M67), L78 (≠ Y71), E96 (= E89), K97 (= K90)
Sites not aligning to the query:
1evjA Crystal structure of glucose-fructose oxidoreductase (gfor) delta1-22 s64d (see paper)
25% identity, 62% coverage: 7:197/308 of query aligns to 6:214/340 of 1evjA
- active site: K100 (= K90), Y188 (≠ N172)
- binding nicotinamide-adenine-dinucleotide: G9 (= G10), L10 (≠ V11), G11 (= G12), K12 (= K13), Y13 (≠ I14), D35 (vs. gap), L77 (≠ M67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W170 (= W157), R171 (≠ I158), Y188 (≠ N172)
Sites not aligning to the query:
1rydA Crystal structure of glucose-fructose oxidoreductase from zymomonas mobilis
25% identity, 62% coverage: 7:197/308 of query aligns to 35:243/381 of 1rydA
- active site: K129 (= K90), Y217 (≠ N172)
- binding alpha-D-glucopyranose: Y236 (≠ A190)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L39 (≠ V11), G40 (= G12), K41 (= K13), Y42 (≠ I14), S64 (= S36), G65 (≠ R37), K69 (≠ V41), Y87 (vs. gap), L106 (≠ M67), P107 (= P68), N108 (≠ P69), L110 (≠ Y71), H111 (≠ R72), E128 (= E89), K129 (= K90), R157 (≠ H118), A196 (≠ N154), W199 (= W157), R200 (≠ I158), Y217 (≠ N172)
Sites not aligning to the query:
1h6dA Oxidized precursor form of glucose-fructose oxidoreductase from zymomonas mobilis complexed with glycerol (see paper)
25% identity, 62% coverage: 7:197/308 of query aligns to 37:245/383 of 1h6dA
- active site: K131 (= K90), Y219 (≠ N172)
- binding glycerol: K131 (= K90), R202 (≠ I158), D215 (= D168), Y219 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G40 (= G10), L41 (≠ V11), G42 (= G12), K43 (= K13), Y44 (≠ I14), S66 (= S36), G67 (≠ R37), K71 (≠ V41), Y89 (vs. gap), I107 (≠ C66), L108 (≠ M67), P109 (= P68), N110 (≠ P69), H113 (≠ R72), E130 (= E89), K131 (= K90), R159 (≠ H118), A198 (≠ N154), W201 (= W157), R202 (≠ I158), Y219 (≠ N172)
Sites not aligning to the query:
2poqX Dimeric dihydrodiol dehydrogenase complexed with inhibitor, isoascorbic acid (see paper)
30% identity, 37% coverage: 69:181/308 of query aligns to 76:188/331 of 2poqX
Sites not aligning to the query:
2o4uX Crystal structure of mammalian dimeric dihydrodiol dehydrogenase (see paper)
30% identity, 37% coverage: 69:181/308 of query aligns to 76:188/331 of 2o4uX
Sites not aligning to the query:
- binding phosphate ion: 1, 2, 8, 9, 35, 36, 40, 57, 232, 234, 236, 247, 250, 253, 292, 296, 318
Q7JK39 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; Jmo2DD; EC 1.3.1.20; EC 1.1.1.179 from Macaca fuscata fuscata (Japanese macaque) (see paper)
30% identity, 37% coverage: 69:181/308 of query aligns to 77:189/334 of Q7JK39
- H79 (≠ Y71) mutation to E: Decrease in K(d) and K(m) value for NADPH. Elimination of the fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation. Potent inhibition of the dehydrogenase activity by high ionic strength.
- Y180 (≠ N172) mutation to F: Significant loss of activity. No effect on the high affinity for NADPH, fluorescence-energy transfer and enhancement of NADPH fluorescence by the binary complex formation.
Q9TQS6 Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase; Cmo2DD; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; Dimeric dihydrodiol dehydrogenase; EC 1.3.1.20; EC 1.1.1.179 from Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey) (see paper)
30% identity, 37% coverage: 69:181/308 of query aligns to 77:189/334 of Q9TQS6
- R148 (= R141) mutation to A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-202.
Sites not aligning to the query:
- 202 R→A: No effect on activity. Reduced activity and exhibits significant temperature sensitivity; when associated with A-148.
1zh8A Crystal structure of oxidoreductase (tm0312) from thermotoga maritima at 2.50 a resolution
22% identity, 95% coverage: 1:293/308 of query aligns to 1:304/325 of 1zh8A
- active site: K98 (= K90), H187 (≠ N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: G10 (= G10), C11 (≠ V11), G12 (= G12), I13 (≠ K13), A14 (≠ I14), S37 (= S36), R38 (= R37), T39 (≠ H38), H42 (vs. gap), T74 (≠ C66), L75 (≠ M67), P76 (= P68), L79 (≠ Y71), E97 (= E89), K98 (= K90), N126 (≠ H118), Y165 (≠ H152), W170 (= W157), R171 (≠ I158), H187 (≠ N172), Y276 (= Y265)
4nheB The crystal structure of oxidoreductase (gfo/idh/moca family) from streptococcus pneumoniae tigr4 in complex with NADP
26% identity, 44% coverage: 4:137/308 of query aligns to 3:141/326 of 4nheB
- active site: K94 (= K90)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: T10 (≠ V11), I13 (= I14), S34 (= S36), R35 (= R37), T39 (vs. gap), A70 (≠ C66), S71 (≠ M67), P72 (= P68), N73 (≠ P69), H76 (≠ R72), E93 (= E89), K94 (= K90), R122 (≠ H118)
Sites not aligning to the query:
7x2yA Crystal structure of cis-4,5-dihydrodiol phthalate dehydrogenase in complex with NAD+ and 3-hydroxybenzoate (see paper)
24% identity, 45% coverage: 4:143/308 of query aligns to 4:148/342 of 7x2yA
- binding 3-hydroxybenzoic acid: H122 (≠ W117)
- binding nicotinamide-adenine-dinucleotide: G10 (= G10), G12 (= G12), R13 (≠ K13), A14 (≠ I14), D35 (≠ S36), P36 (≠ R37), R37 (≠ H38), A71 (≠ C66), S72 (≠ M67), P73 (= P68), F76 (≠ Y71), Q80 (≠ A75), E94 (= E89), K95 (= K90), P96 (= P91)
Sites not aligning to the query:
6ktkC Crystal structure of scyllo-inositol dehydrogenase r178a mutant, complexed with nadh and l-glucono-1,5-lactone, from paracoccus laeviglucosivorans (see paper)
34% identity, 41% coverage: 35:160/308 of query aligns to 50:173/368 of 6ktkC
- binding L-glucono-1,5-lactone: K101 (= K90), Y130 (≠ S119), Y158 (≠ W144), E160 (= E146), Y162 (≠ V148)
- binding 1,4-dihydronicotinamide adenine dinucleotide: T77 (≠ C66), T78 (≠ M67), N80 (≠ P69), H83 (≠ R72), E100 (= E89), K101 (= K90), N129 (≠ H118)
Sites not aligning to the query:
5yaqB Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with scyllo-inosose (see paper)
34% identity, 41% coverage: 35:159/308 of query aligns to 49:171/366 of 5yaqB
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: K100 (= K90), Y129 (≠ S119), Y157 (≠ W144), E159 (= E146)
- binding nicotinamide-adenine-dinucleotide: T76 (≠ C66), T77 (≠ M67), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), N128 (≠ H118)
Sites not aligning to the query:
- binding (2R,3S,4s,5R,6S)-2,3,4,5,6-pentahydroxycyclohexanone: 172, 185, 189
- binding nicotinamide-adenine-dinucleotide: 8, 9, 10, 11, 12, 39, 40, 172, 189
5ya8A Crystal structure of scyllo-inositol dehydrogenase with l-glucose dehydrogenase activity complexed with myo-inositol (see paper)
34% identity, 41% coverage: 35:159/308 of query aligns to 49:171/366 of 5ya8A
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: K100 (= K90), Y129 (≠ S119), Y157 (≠ W144), E159 (= E146)
- binding nicotinamide-adenine-dinucleotide: T76 (≠ C66), T77 (≠ M67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), N128 (≠ H118)
Sites not aligning to the query:
- binding 1,2,3,4,5,6-hexahydroxy-cyclohexane: 172, 185, 189
- binding nicotinamide-adenine-dinucleotide: 9, 10, 11, 12, 39, 40, 189
5a05A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with maltotriose (see paper)
26% identity, 57% coverage: 4:180/308 of query aligns to 3:193/335 of 5a05A
- active site: K100 (= K90), Y185 (≠ N172)
- binding beta-D-glucopyranose: K100 (= K90), F159 (vs. gap), D181 (= D168), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ V11), G11 (= G12), Y12 (≠ K13), Y13 (≠ I14), S35 (= S36), G36 (vs. gap), T37 (vs. gap), K40 (vs. gap), Y58 (≠ F47), I76 (≠ C66), T77 (≠ M67), P78 (= P68), N79 (≠ P69), L81 (≠ Y71), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
Sites not aligning to the query:
5a04A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glucose (see paper)
26% identity, 57% coverage: 4:180/308 of query aligns to 3:193/335 of 5a04A
- active site: K100 (= K90), Y185 (≠ N172)
- binding beta-D-glucopyranose: K100 (= K90), F159 (vs. gap), R168 (≠ H152), D181 (= D168), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: L10 (≠ V11), G11 (= G12), Y12 (≠ K13), Y13 (≠ I14), S35 (= S36), G36 (vs. gap), T37 (vs. gap), K40 (vs. gap), Y58 (≠ F47), I76 (≠ C66), T77 (≠ M67), P78 (= P68), N79 (≠ P69), L81 (≠ Y71), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
Sites not aligning to the query:
5a03E Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with xylose (see paper)
26% identity, 57% coverage: 4:180/308 of query aligns to 3:193/335 of 5a03E
- active site: K100 (= K90), Y185 (≠ N172)
- binding nadph dihydro-nicotinamide-adenine-dinucleotide phosphate: G9 (= G10), L10 (≠ V11), G11 (= G12), Y12 (≠ K13), Y13 (≠ I14), S35 (= S36), G36 (vs. gap), T37 (vs. gap), K40 (vs. gap), Y58 (≠ F47), I76 (≠ C66), T77 (≠ M67), P78 (= P68), N79 (≠ P69), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
- binding beta-D-xylopyranose: K100 (= K90), F159 (vs. gap), R168 (≠ H152), D181 (= D168), Y185 (≠ N172)
- binding alpha-D-xylopyranose: H134 (≠ P123)
Sites not aligning to the query:
5a02A Crystal structure of aldose-aldose oxidoreductase from caulobacter crescentus complexed with glycerol (see paper)
26% identity, 57% coverage: 4:180/308 of query aligns to 3:193/335 of 5a02A
- active site: K100 (= K90), Y185 (≠ N172)
- binding nadp nicotinamide-adenine-dinucleotide phosphate: L10 (≠ V11), G11 (= G12), Y12 (≠ K13), Y13 (≠ I14), S35 (= S36), G36 (vs. gap), T37 (vs. gap), K40 (vs. gap), Y58 (≠ F47), I76 (≠ C66), T77 (≠ M67), P78 (= P68), L81 (≠ Y71), H82 (≠ R72), E99 (= E89), K100 (= K90), R128 (≠ H118), W167 (= W151), R168 (≠ H152), Y185 (≠ N172)
Sites not aligning to the query:
Query Sequence
>SMc00588 FitnessBrowser__Smeli:SMc00588
MSPINIAIVGVGKIVRDQHLPALAKNADYRLIAAASRHGTVDGIDNFKSIEAMIDAVPAV
EAVSLCMPPQYRYEAARTALAAGKHVFLEKPPGATLSEVADLEALAEEKGVSLFASWHSR
YAPAVEAAKTFLASAAIRNVRIIWKEDVRHWHPNQEWIWAAGGLGVFDPGINALSIMTHI
LPRPVFITSATLEFPENRDAPIAATIAFSDAEKLDVAAEFDWRQTGKQSWDIVAETDAGG
MVLSEGGAKLAIDGKIVHEEPEQEYPMLYRRFAEIIKAGRSDVDLAPLRHVADAFMLGRR
KFVEAFHD
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory