Comparing SMc00672 FitnessBrowser__Smeli:SMc00672 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 6 hits to proteins with known functional sites (download)
7yleA Rndmpx in complex with dmsp (see paper)
30% identity, 91% coverage: 29:341/344 of query aligns to 2:296/299 of 7yleA
1r9qA Structure analysis of prox in complex with proline betaine (see paper)
26% identity, 74% coverage: 79:333/344 of query aligns to 54:303/309 of 1r9qA
Sites not aligning to the query:
P0AFM2 Glycine betaine/proline betaine-binding periplasmic protein; GBBP from Escherichia coli (strain K12) (see 2 papers)
26% identity, 74% coverage: 79:333/344 of query aligns to 75:324/330 of P0AFM2
Sites not aligning to the query:
Q4FL33 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Pelagibacter ubique (strain HTCC1062) (see paper)
22% identity, 86% coverage: 33:328/344 of query aligns to 29:310/314 of Q4FL33
Q5LT66 Trimethylamine N-oxide-binding protein; TMAO-binding protein from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) (Silicibacter pomeroyi) (see paper)
22% identity, 85% coverage: 41:332/344 of query aligns to 54:332/333 of Q5LT66
Sites not aligning to the query:
4xz6A Tmox in complex with tmao (see paper)
22% identity, 85% coverage: 41:332/344 of query aligns to 12:290/291 of 4xz6A
>SMc00672 FitnessBrowser__Smeli:SMc00672
MSISTMRLTFAAAGLMLAASASGANASYCGDGKTVTFAGIDWESGAFITEVMKTILSKGY
DCQVDSIPGNSVTLEQATANNDVQIFAEEWLGRSDVWNKAVEEKKVIAVGKTFVGASEGW
FVPDYVVHGDPARNIEAKAPDLKSVSQLTDPKIAEIFADPEEPSKGRFLNCPSGWTCEGV
STAKLEAYKLGETYVNFRPGTGTALDAAITSAYLQGEPILFYYWSPTAILGKFKLIQLEE
PAYNEACWKELSSANGKRDEGCAFPSVDVAYGVNSTFASEAPEIVEILEKATFPLDEVNA
SLAYMADNKVDATAAAAEFLKTKGDIWSKWVSDEARGKIEAGLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory