Comparing SMc00673 FitnessBrowser__Smeli:SMc00673 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 16 hits to proteins with known functional sites (download)
4rdvB The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-formimino-l-aspartate
58% identity, 98% coverage: 9:460/461 of query aligns to 3:450/451 of 4rdvB
3mduA The structure of n-formimino-l-glutamate iminohydrolase from pseudomonas aeruginosa complexed with n-guanidino-l-glutamate (see paper)
58% identity, 98% coverage: 9:460/461 of query aligns to 3:450/450 of 3mduA
Q9HU77 Formimidoylglutamate deiminase; Formiminoglutamate deiminase; N-formimino-L-glutamate deiminase; N-formimino-L-glutamate iminohydrolase; EC 3.5.3.13 from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) (see 2 papers)
58% identity, 98% coverage: 9:460/461 of query aligns to 4:451/453 of Q9HU77
4f0lB Crystal structure of amidohydrolase from brucella melitensis
53% identity, 99% coverage: 5:460/461 of query aligns to 1:447/449 of 4f0lB
4dzhA Crystal structure of an adenosine deaminase from xanthomonas campestris (target nysgrc-200456) with bound zn
26% identity, 84% coverage: 54:438/461 of query aligns to 62:412/439 of 4dzhA
Q58936 5'-deoxyadenosine deaminase; 5'-dA deaminase; 5'-methylthioadenosine deaminase; MTA deaminase; Adenosine deaminase; S-adenosylhomocysteine deaminase; SAH deaminase; EC 3.5.4.41; EC 3.5.4.31; EC 3.5.4.4; EC 3.5.4.28 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
27% identity, 45% coverage: 234:442/461 of query aligns to 199:398/420 of Q58936
Sites not aligning to the query:
3lnpA Crystal structure of amidohydrolase family protein olei01672_1_465 from oleispira antarctica (see paper)
23% identity, 89% coverage: 32:442/461 of query aligns to 33:418/441 of 3lnpA
4gbdA Crystal structure of adenosine deaminase from pseudomonas aeruginosa pao1 with bound zn and methylthio-coformycin (see paper)
26% identity, 54% coverage: 206:452/461 of query aligns to 183:426/435 of 4gbdA
Sites not aligning to the query:
4dykA Crystal structure of an adenosine deaminase from pseudomonas aeruginosa pao1 (target nysgrc-200449) with bound zn
26% identity, 54% coverage: 206:452/461 of query aligns to 183:426/437 of 4dykA
Sites not aligning to the query:
2plmA Crystal structure of the protein tm0936 from thermotoga maritima complexed with zn and s-inosylhomocysteine (see paper)
24% identity, 93% coverage: 32:460/461 of query aligns to 26:403/404 of 2plmA
1p1mA Structure of thermotoga maritima amidohydrolase tm0936 bound to ni and methionine
24% identity, 93% coverage: 32:460/461 of query aligns to 26:403/404 of 1p1mA
4f0sA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) with bound inosine.
24% identity, 85% coverage: 47:439/461 of query aligns to 48:409/434 of 4f0sA
4f0rA Crystal structure of an adenosine deaminase homolog from chromobacterium violaceum (target nysgrc-019589) bound zn and 5'- methylthioadenosine (unproductive complex)
24% identity, 85% coverage: 47:439/461 of query aligns to 48:409/436 of 4f0rA
2imrA Crystal structure of amidohydrolase dr_0824 from deinococcus radiodurans
28% identity, 27% coverage: 204:327/461 of query aligns to 167:317/380 of 2imrA
Sites not aligning to the query:
4v1xE The structure of the hexameric atrazine chlorohydrolase, atza (see paper)
24% identity, 41% coverage: 254:442/461 of query aligns to 255:436/474 of 4v1xE
Sites not aligning to the query:
P72156 Atrazine chlorohydrolase; EC 3.8.1.8 from Pseudomonas sp. (strain ADP) (see 2 papers)
24% identity, 41% coverage: 254:442/461 of query aligns to 255:436/474 of P72156
Sites not aligning to the query:
>SMc00673 FitnessBrowser__Smeli:SMc00673
MTASSAHRLFAEQALLPTGWSENVAISVDAAGRILAVEAGQSKAPGDEHLSGPIVPAMAN
LHSHAFQRAMAGLAEVAGTGDDSFWTWREEMYRTVGLVDPDDLEAIAAKLYVEMLKGGFG
RVVEFHYLHHQLDGTPYADPAEMSLRILRAAQTTGIGLTHLPVFYAHANFGGAAPSAGQR
PFLHDPDRFLALLERLSPACNATGARLGYAIHSLRAATPEEMREILQSSPLTGPIHIHVA
EQPREVEDCLAWSGRRPVEWLLDNMPVDERWCAIHATHMTPDETRRLAHSGAVAGLCPAT
EANLGDGIFPAVDFVAAGGRFGVGTDSHVATSVAEELRLLEYGQRLRDRRRNRLAAPGAS
VGRSIFDAALAGGAQAAGQAAGMEEPGIRVGAMADLVVLDGSNPYIAAASGNQILDRWLF
ALGGDTVRDVMIAGEWKIRNGRHDREEDIDRAFARVLNKLK
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory