SitesBLAST
Comparing SMc00833 FitnessBrowser__Smeli:SMc00833 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
P9WIT1 Uncharacterized FAD-linked oxidoreductase Rv2280; EC 1.-.-.- from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
26% identity, 97% coverage: 6:397/405 of query aligns to 45:453/459 of P9WIT1
- K354 (≠ L295) modified: Isoglutamyl lysine isopeptide (Lys-Gln) (interchain with Q-Cter in protein Pup)
7qh2C Cryo-em structure of ldh-etfab complex from acetobacterium woodii (see paper)
26% identity, 57% coverage: 8:238/405 of query aligns to 52:278/467 of 7qh2C
- binding flavin-adenine dinucleotide: V73 (= V29), G75 (= G31), S76 (≠ G32), G77 (= G33), T78 (= T34), G79 (vs. gap), L80 (≠ R35), A83 (≠ L38), C84 (≠ G39), P137 (≠ T102), G138 (= G103), E139 (= E104), A142 (vs. gap), T143 (= T106), G146 (= G109), N147 (≠ V110), S149 (≠ A112), T150 (≠ A113), A152 (≠ V115), G153 (≠ S116), E203 (≠ Y166), G204 (= G167), I209 (≠ L172)
Sites not aligning to the query:
4bc7B Mammalian alkyldihydroxyacetonephosphate synthase: arg419his mutant (see paper)
25% identity, 64% coverage: 7:264/405 of query aligns to 118:377/543 of 4bc7B
- binding flavin-adenine dinucleotide: P140 (≠ V29), G142 (= G31), G143 (= G32), G144 (= G33), T145 (= T34), S146 (≠ R35), V147 (≠ A36), G150 (= G39), L151 (≠ N40), P208 (= P92), D209 (≠ A100), S210 (≠ T101), S214 (≠ P105), T215 (= T106), G218 (= G109), S221 (≠ A112), T222 (≠ A113), A224 (≠ V115), S225 (= S116), E274 (≠ Y166), G275 (= G167), I280 (≠ L172)
Sites not aligning to the query:
3pm9A Crystal structure of a putative dehydrogenase (rpa1076) from rhodopseudomonas palustris cga009 at 2.57 a resolution
30% identity, 46% coverage: 5:191/405 of query aligns to 45:225/465 of 3pm9A
- active site: A149 (≠ V115), L159 (≠ A125)
- binding flavin-adenine dinucleotide: P69 (≠ V29), Q70 (≠ V30), G71 (= G31), G72 (= G32), N73 (≠ G33), T74 (= T34), G75 (vs. gap), L76 (≠ R35), G79 (≠ L38), Q80 (≠ G39), L91 (≠ T50), L133 (≠ F99), G134 (≠ A100), A135 (≠ T101), C139 (≠ P105), T140 (= T106), G142 (= G108), G143 (= G109), S146 (≠ A112), T147 (≠ A113), A149 (≠ V115), G150 (≠ S116), E200 (≠ Y166), G201 (= G167), I205 (= I171), I206 (≠ L172)
Sites not aligning to the query:
O00116 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Aging-associated gene 5 protein; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Homo sapiens (Human) (see 2 papers)
26% identity, 50% coverage: 7:209/405 of query aligns to 212:411/658 of O00116
Sites not aligning to the query:
- 182 R → Q: in RCDP3; severely reduced protein levels
- 419 Important for enzyme activity; R → H: in RCDP3; loss of enzyme activity; dbSNP:rs121434411
- 471 E → K: in RCDP3; severely reduced protein levels
- 568 T → M: in RCDP3; does not affect protein levels; dbSNP:rs387907214
6gouA Development of alkyl glycerone phosphate synthase inhibitors: complex with inhibitor 2i (see paper)
25% identity, 64% coverage: 7:264/405 of query aligns to 132:388/554 of 6gouA
- binding (3~{S})-3-[2,6-bis(fluoranyl)phenyl]-~{N}-[(2-oxidanylidene-1,3-dihydrobenzimidazol-5-yl)methyl]butanamide: D223 (≠ A100)
- binding flavin-adenine dinucleotide: P154 (≠ V29), I155 (≠ V30), G156 (= G31), G157 (= G32), G158 (= G33), T159 (= T34), S160 (≠ R35), V161 (≠ A36), G164 (= G39), P222 (= P92), D223 (≠ A100), S224 (≠ T101), S228 (≠ P105), T229 (= T106), G232 (= G109), W233 (≠ V110), S235 (≠ A112), T236 (≠ A113), A238 (≠ V115), S239 (= S116), E288 (≠ Y166), V293 (≠ I171), I294 (≠ L172)
Sites not aligning to the query:
5ae2B Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 118:317/542 of 5ae2B
- binding flavin-adenine dinucleotide: P140 (≠ V29), G142 (= G31), G143 (= G32), G144 (= G33), T145 (= T34), S146 (≠ R35), G150 (= G39), L151 (≠ N40), P208 (= P92), D209 (≠ A100), S210 (≠ T101), S214 (≠ P105), T215 (= T106), G218 (= G109), W219 (≠ V110), S221 (≠ A112), T222 (≠ A113), A224 (≠ V115), S225 (= S116), E274 (≠ Y166), G275 (= G167), V279 (≠ I171), I280 (≠ L172)
Sites not aligning to the query:
- binding flavin-adenine dinucleotide: 16, 500
- binding 3-(2-fluorophenyl)-2-methyl-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)acrylamide: 399, 409, 410, 411, 462, 464, 466, 500, 501
4bc9B Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 118:317/542 of 4bc9B
- binding propanenitrile: D209 (≠ A100)
- binding flavin-adenine dinucleotide: P140 (≠ V29), G142 (= G31), G143 (= G32), G144 (= G33), T145 (= T34), S146 (≠ R35), V147 (≠ A36), G150 (= G39), L151 (≠ N40), P208 (= P92), D209 (≠ A100), S210 (≠ T101), S214 (≠ P105), T215 (= T106), G218 (= G109), W219 (≠ V110), S221 (≠ A112), T222 (≠ A113), A224 (≠ V115), S225 (= S116), E274 (≠ Y166), G275 (= G167), I280 (≠ L172)
Sites not aligning to the query:
5ae3A Ether lipid-generating enzyme agps in complex with antimycin a (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 118:317/539 of 5ae3A
- binding flavin-adenine dinucleotide: P140 (≠ V29), I141 (≠ V30), G142 (= G31), G143 (= G32), G144 (= G33), T145 (= T34), S146 (≠ R35), V147 (≠ A36), L151 (≠ N40), P208 (= P92), D209 (≠ A100), S210 (≠ T101), S214 (≠ P105), T215 (= T106), G218 (= G109), W219 (≠ V110), S221 (≠ A112), T222 (≠ A113), A224 (≠ V115), S225 (= S116), E274 (≠ Y166), V279 (≠ I171), I280 (≠ L172)
Sites not aligning to the query:
- binding [(2R,3S,6S,7R,8R)-3-[(3-formamido-2-oxidanyl-phenyl)carbonylamino]-8-hexyl-2,6-dimethyl-4,9-bis(oxidanylidene)-1,5-dioxonan-7-yl] 3-methylbutanoate: 45, 49, 53, 325, 327, 331, 334, 349, 386, 393, 396, 400, 447, 461
- binding flavin-adenine dinucleotide: 497
5ae1B Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 118:317/539 of 5ae1B
- binding flavin-adenine dinucleotide: P140 (≠ V29), I141 (≠ V30), G142 (= G31), G143 (= G32), G144 (= G33), T145 (= T34), S146 (≠ R35), G150 (= G39), L151 (≠ N40), P208 (= P92), D209 (≠ A100), S210 (≠ T101), S214 (≠ P105), T215 (= T106), G218 (= G109), W219 (≠ V110), S221 (≠ A112), T222 (≠ A113), A224 (≠ V115), S225 (= S116), E274 (≠ Y166), V279 (≠ I171), I280 (≠ L172)
Sites not aligning to the query:
5adzC Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 132:331/557 of 5adzC
- binding flavin-adenine dinucleotide: P154 (≠ V29), I155 (≠ V30), G156 (= G31), G157 (= G32), G158 (= G33), T159 (= T34), S160 (≠ R35), P222 (= P92), D223 (≠ A100), S224 (≠ T101), S228 (≠ P105), T229 (= T106), G232 (= G109), W233 (≠ V110), S235 (≠ A112), T236 (≠ A113), A238 (≠ V115), S239 (= S116), E288 (≠ Y166), G289 (= G167), I294 (≠ L172)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D223 (≠ A100)
Sites not aligning to the query:
5ae2A Ether lipid-generating enzyme agps in complex with inhibitor 1e (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 123:322/561 of 5ae2A
- binding flavin-adenine dinucleotide: P145 (≠ V29), I146 (≠ V30), G147 (= G31), G148 (= G32), G149 (= G33), T150 (= T34), S151 (≠ R35), G155 (= G39), L156 (≠ N40), P213 (= P92), D214 (≠ A100), S215 (≠ T101), S219 (≠ P105), T220 (= T106), G223 (= G109), W224 (≠ V110), S226 (≠ A112), T227 (≠ A113), A229 (≠ V115), S230 (= S116), E279 (≠ Y166), V284 (≠ I171), I285 (≠ L172)
Sites not aligning to the query:
5ae1A Ether lipid-generating enzyme agps in complex with inhibitor zinc69435460 (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 117:316/560 of 5ae1A
- binding flavin-adenine dinucleotide: P139 (≠ V29), I140 (≠ V30), G141 (= G31), G142 (= G32), G143 (= G33), T144 (= T34), S145 (≠ R35), V146 (≠ A36), G149 (= G39), L150 (≠ N40), P207 (= P92), D208 (≠ A100), S209 (≠ T101), S213 (≠ P105), T214 (= T106), G216 (= G108), G217 (= G109), W218 (≠ V110), S220 (≠ A112), T221 (≠ A113), A223 (≠ V115), S224 (= S116), E273 (≠ Y166), G274 (= G167), V278 (≠ I171), I279 (≠ L172)
Sites not aligning to the query:
5adzA Ether lipid-generating enzyme agps in complex with inhibitor 1a (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 120:319/566 of 5adzA
- binding flavin-adenine dinucleotide: P142 (≠ V29), I143 (≠ V30), G144 (= G31), G145 (= G32), G146 (= G33), T147 (= T34), S148 (≠ R35), G152 (= G39), P210 (= P92), D211 (≠ A100), S212 (≠ T101), S216 (≠ P105), T217 (= T106), G220 (= G109), W221 (≠ V110), S223 (≠ A112), T224 (≠ A113), A226 (≠ V115), S227 (= S116), E276 (≠ Y166), G277 (= G167), V281 (≠ I171), I282 (≠ L172)
- binding (3S)-3-(2-fluorophenyl)-N-((2-oxo-2,3-dihydro-1H-benzo[d]imidazol-5-yl)methyl)butanamide): D211 (≠ A100)
Sites not aligning to the query:
4bc9A Mammalian alkyldihydroxyacetonephosphate synthase: wild-type, adduct with cyanoethyl (see paper)
26% identity, 50% coverage: 7:209/405 of query aligns to 123:322/555 of 4bc9A
- binding propanenitrile: D214 (≠ A100)
- binding flavin-adenine dinucleotide: P145 (≠ V29), I146 (≠ V30), G147 (= G31), G148 (= G32), G149 (= G33), T150 (= T34), S151 (≠ R35), V152 (≠ A36), G155 (= G39), L156 (≠ N40), P213 (= P92), D214 (≠ A100), S215 (≠ T101), S219 (≠ P105), T220 (= T106), G223 (= G109), W224 (≠ V110), S226 (≠ A112), T227 (≠ A113), A229 (≠ V115), S230 (= S116), E279 (≠ Y166), V284 (≠ I171), I285 (≠ L172)
Sites not aligning to the query:
6lpnB Crystal structure of human d-2-hydroxyglutarate dehydrogenase in apo form (see paper)
23% identity, 98% coverage: 3:399/405 of query aligns to 50:464/467 of 6lpnB
- binding flavin-adenine dinucleotide: P76 (≠ V29), G78 (= G31), G79 (= G32), N80 (≠ G33), T81 (= T34), G82 (vs. gap), M83 (≠ R35), G86 (≠ L38), S87 (≠ G39), L140 (≠ F99), A142 (≠ T101), C146 (≠ P105), H147 (≠ T106), G150 (= G109), N151 (≠ V110), A153 (= A112), T154 (≠ A113), G208 (= G167), I212 (= I171), I213 (≠ L172), E423 (vs. gap), N460 (= N395)
Sites not aligning to the query:
P97275 Alkyldihydroxyacetonephosphate synthase, peroxisomal; Alkyl-DHAP synthase; Alkylglycerone-phosphate synthase; EC 2.5.1.26 from Cavia porcellus (Guinea pig) (see 4 papers)
26% identity, 50% coverage: 7:209/405 of query aligns to 212:411/658 of P97275
- 234:240 (vs. 29:35, 57% identical) binding
- H300 (≠ F90) mutation to A: Loss of activity.
- 303:309 (vs. 100:106, 14% identical) binding
- T309 (= T106) mutation to I: Impaired FAD binding and protein stability. Loss of activity.
- TRAS 316:319 (≠ ANVS 113:116) binding
- S367 (= S165) mutation to A: Strongly reduced activity.
- 368:374 (vs. 166:172, 57% identical) binding
Sites not aligning to the query:
- 1:58 modified: transit peptide, Peroxisome
- 419 Important for enzyme activity; R→H: Loss of activity.; R→K: Strongly reduced activity.
- 469 L→P: Impaired FAD binding and protein stability. Loss of activity.
- 515 binding ; R→L: Impaired FAD binding and protein stability. Loss of activity.
- 576 C→A: No effect on activity.
- 578 active site, Proton donor/acceptor; Y→F: Loss of activity.
- 615 H→A: Loss of activity.
- 615:617 Important for enzyme activity
- 616 H→A: Loss of activity.
- 617 H→A: Loss of activity.
- 654:658 Important for enzyme activity
Q8N465 D-2-hydroxyglutarate dehydrogenase, mitochondrial; EC 1.1.99.39 from Homo sapiens (Human) (see 7 papers)
24% identity, 97% coverage: 3:396/405 of query aligns to 102:513/521 of Q8N465
- S109 (≠ E10) to W: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs142050154
- N127 (≠ A28) to K: in D2HGA1; uncertain significance; complete loss of catalytic activity; dbSNP:rs762857195
- G131 (= G32) to V: in D2HGA1; uncertain significance; complete loss of catalytic activity
- I147 (≠ T47) to S: in D2HGA1; uncertain significance; severe phenotype; almost complete loss of catalytic activity; dbSNP:rs121434361
- M153 (≠ L53) to T: in D2HGA1; uncertain significance; significant loss of catalytic activity; to V: in D2HGA1; uncertain significance; significant loss of catalytic activity; dbSNP:rs1432270139
- C172 (≠ T72) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs773735172
- P189 (= P92) to L: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs587783517
- A205 (= A112) to V: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs750889931
- A231 (≠ G138) to V: in D2HGA1; uncertain significance; significant loss of catalytic activity
- G233 (= G140) to S: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs374535734
- D375 (= D270) to Y: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs267606759
- R386 (vs. gap) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- T390 (vs. gap) binding ; binding ; mutation to A: Significantly reduced catalytic activity.
- V399 (≠ P286) to M: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746519212
- K401 (≠ A288) binding ; binding ; mutation to A: Loss of catalytic activity.
- R419 (= R313) to H: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs199908032
- A426 (= A320) to T: in D2HGA1; uncertain significance; no effect on catalytic activity; dbSNP:rs146578303
- H434 (≠ G327) binding ; mutation to A: Loss of catalytic activity.
- G436 (≠ V329) to V: slight reduction in catalytic activity
- N439 (≠ R332) to D: in D2HGA1; uncertain significance; mild phenotype; moderate reduction in catalytic activity; dbSNP:rs121434362
- H441 (≠ E334) binding ; mutation to A: Loss of catalytic activity.
- N443 (≠ D336) binding ; mutation to A: Significantly reduced catalytic activity.
- V444 (≠ P337) to A: in D2HGA1; uncertain significance; severe phenotype; significant reduction in catalytic activity; dbSNP:rs121434360
- A446 (= A339) to V: in D2HGA1; uncertain significance; moderate reduction in catalytic activity; dbSNP:rs746956176
- E475 (vs. gap) binding ; mutation to A: Loss of catalytic activity.
- H476 (vs. gap) binding ; binding ; binding ; mutation to A: Loss of catalytic activity.
- G477 (vs. gap) to R: in D2HGA1; uncertain significance; almost complete loss of catalytic activity; dbSNP:rs1453924640
Sites not aligning to the query:
- 15 R → G: in dbSNP:rs4675887
- 169:521 natural variant: Missing (in D2HGA1; uncertain significance)
- 400:521 natural variant: Missing (in D2HGA1; uncertain significance; complete loss of catalytic activity)
6lpxA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with 2-oxoglutarate (2-og) (see paper)
23% identity, 98% coverage: 3:399/405 of query aligns to 49:463/466 of 6lpxA
- binding 2-oxoglutaric acid: R333 (vs. gap), T337 (vs. gap), K348 (≠ A288), Y379 (≠ Q325), H381 (≠ G327), H388 (≠ E334), H423 (vs. gap)
- binding flavin-adenine dinucleotide: P75 (≠ V29), Q76 (≠ V30), G77 (= G31), G78 (= G32), N79 (≠ G33), T80 (= T34), G81 (vs. gap), M82 (≠ R35), G85 (≠ L38), S86 (≠ G39), L139 (≠ F99), G140 (≠ A100), A141 (≠ T101), C145 (≠ P105), G149 (= G109), N150 (≠ V110), A152 (= A112), T153 (≠ A113), G157 (= G117), G207 (= G167), I212 (≠ L172), E422 (vs. gap), N459 (= N395)
- binding zinc ion: H381 (≠ G327), H388 (≠ E334), E422 (vs. gap)
Sites not aligning to the query:
6lpuA Crystal structure of human d-2-hydroxyglutarate dehydrogenase in complex with l-2-hydroxyglutarate (l-2-hg) (see paper)
23% identity, 98% coverage: 3:399/405 of query aligns to 49:463/466 of 6lpuA
- binding flavin-adenine dinucleotide: P75 (≠ V29), G77 (= G31), G78 (= G32), N79 (≠ G33), T80 (= T34), G81 (vs. gap), G85 (≠ L38), S86 (≠ G39), L139 (≠ F99), G140 (≠ A100), A141 (≠ T101), C145 (≠ P105), H146 (≠ T106), G148 (= G108), G149 (= G109), N150 (≠ V110), A152 (= A112), T153 (≠ A113), A155 (≠ V115), E206 (≠ Y166), G207 (= G167), I211 (= I171), I212 (≠ L172), E422 (vs. gap), N459 (= N395)
- binding (2s)-2-hydroxypentanedioic acid: R333 (vs. gap), T337 (vs. gap), K348 (≠ A288), Y379 (≠ Q325), H381 (≠ G327), H388 (≠ E334), H423 (vs. gap)
- binding zinc ion: H381 (≠ G327), H388 (≠ E334), E422 (vs. gap)
Sites not aligning to the query:
Query Sequence
>SMc00833 FitnessBrowser__Smeli:SMc00833
MIVHFEPASEEGIASVVRSAAAERVTLAVVGGGTRAGLGNPVRADRTLSTRRLSGIVTYD
PAEMTMSALAGTPVAEVEAALHAKGQMLSFEPMDHRPIFATTGEPTIGGVFAANVSGPRR
YVAGAARDSLLGVRFVNGRGEPIKAGGRVMKNVTGLDLVKLMAGSYGTLGILTEVTFKVL
PLPPAAATVVVSGLNDAEAAAVMAEAMAQPVEVSGASHLPESVRSRFLDGALPDGAATVL
RLEGLAASVAIRAEKLGEKLSRFGRISQLDEAQTRTLWAEIRDVKPYADGTRRPLWRISV
APSAGHQLVAALRLQTGVDAFYDWQGGLVWLRMEADPEAELLRRYIGAVGGGHAALLRAG
EEARGRIPAFEPQPPAVARLSERIRAQFDPSGIFNPGRAAALVRN
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory