Comparing SMc00962 FitnessBrowser__Smeli:SMc00962 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
D5ARH0 Biotin transport ATP-binding protein BioM; ECF transporter A component BioM; EC 7.6.2.- from Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) (see paper)
43% identity, 88% coverage: 21:220/226 of query aligns to 22:221/234 of D5ARH0
8bmsA Cryo-em structure of the mutant solitary ecf module 2eq in msp2n2 lipid nanodiscs in the atpase closed and atp-bound conformation (see paper)
36% identity, 96% coverage: 3:219/226 of query aligns to 5:230/278 of 8bmsA
5d3mA Folate ecf transporter: amppnp bound state (see paper)
36% identity, 96% coverage: 3:219/226 of query aligns to 6:233/280 of 5d3mA
8bmpA Cryo-em structure of the folate-specific ecf transporter complex in msp2n2 lipid nanodiscs bound to atp and adp (see paper)
38% identity, 91% coverage: 15:219/226 of query aligns to 17:230/278 of 8bmpA
Sites not aligning to the query:
Q5M243 Energy-coupling factor transporter ATP-binding protein EcfA1; ECF transporter A component EcfA1; EC 7.-.-.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
37% identity, 86% coverage: 30:223/226 of query aligns to 33:231/276 of Q5M243
5x40A Structure of a cbio dimer bound with amppcp (see paper)
35% identity, 89% coverage: 17:217/226 of query aligns to 20:228/280 of 5x40A
Sites not aligning to the query:
Q5M244 Energy-coupling factor transporter ATP-binding protein EcfA2; ECF transporter A component EcfA2; EC 3.6.3.- from Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) (see paper)
33% identity, 96% coverage: 3:219/226 of query aligns to 8:235/280 of Q5M244
2d62A Crystal structure of multiple sugar binding transport atp- binding protein
33% identity, 96% coverage: 2:219/226 of query aligns to 6:233/375 of 2d62A
1g291 Malk (see paper)
33% identity, 95% coverage: 3:216/226 of query aligns to 4:227/372 of 1g291
Sites not aligning to the query:
7mdyC Lolcde nucleotide-bound
35% identity, 92% coverage: 4:210/226 of query aligns to 11:223/226 of 7mdyC
P75957 Lipoprotein-releasing system ATP-binding protein LolD; EC 7.6.2.- from Escherichia coli (strain K12) (see paper)
35% identity, 92% coverage: 4:210/226 of query aligns to 14:226/233 of P75957
7arlD Lolcde in complex with lipoprotein and adp (see paper)
35% identity, 91% coverage: 4:209/226 of query aligns to 11:222/222 of 7arlD
7v8iD Lolcd(e171q)e with bound amppnp in nanodiscs (see paper)
35% identity, 92% coverage: 4:210/226 of query aligns to 13:225/229 of 7v8iD
4hluC Structure of the ecfa-a' heterodimer bound to adp (see paper)
32% identity, 83% coverage: 32:219/226 of query aligns to 35:222/249 of 4hluC
Sites not aligning to the query:
4u00A Crystal structure of ttha1159 in complex with adp (see paper)
35% identity, 89% coverage: 21:222/226 of query aligns to 23:229/241 of 4u00A
Sites not aligning to the query:
P69874 Spermidine/putrescine import ATP-binding protein PotA; EC 7.6.2.11 from Escherichia coli (strain K12) (see 3 papers)
32% identity, 81% coverage: 32:215/226 of query aligns to 48:234/378 of P69874
Sites not aligning to the query:
4zirA Crystal structure of ecfaa' heterodimer bound to amppnp (see paper)
33% identity, 92% coverage: 14:220/226 of query aligns to 19:227/263 of 4zirA
Sites not aligning to the query:
1oxvD Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 90% coverage: 13:215/226 of query aligns to 16:227/353 of 1oxvD
Sites not aligning to the query:
1oxvA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 90% coverage: 13:215/226 of query aligns to 16:227/353 of 1oxvA
Sites not aligning to the query:
1oxuA Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus (see paper)
34% identity, 90% coverage: 13:215/226 of query aligns to 16:227/353 of 1oxuA
Sites not aligning to the query:
>SMc00962 FitnessBrowser__Smeli:SMc00962
MEIRFTDCSVSFGERVALHPLSLALDERRVGVIGLNGSGKTTFARLINGLVKPTTGRVKV
NGLDTVEDDRAVLTEAGFIFQNPQHQLIMPIVIDDIAFGLKNRGLPAHEISSRTEAVLAR
FGVSHLARRRVHELSGGETQLVAMASVIVTGPKILILDEPTNQLDLRNRRMVAETIDTLD
EDTIVITHDLALAESAERVLLFHEGRLLADGAPDETIRRYHEVAGC
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory