Comparing SMc02775 FitnessBrowser__Smeli:SMc02775 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
7ezlA Rice l-galactose dehydrogenase (holo form)
30% identity, 94% coverage: 1:317/339 of query aligns to 3:294/318 of 7ezlA
7eziA Rice l-galactose dehydrogenase (apo form)
30% identity, 94% coverage: 1:317/339 of query aligns to 8:299/323 of 7eziA
7svqA Crystal structure of l-galactose dehydrogenase from spinacia oleracea in complex with NAD+ (see paper)
27% identity, 95% coverage: 1:323/339 of query aligns to 2:299/315 of 7svqA
P46336 Aldo-keto reductase IolS; AKR11A; Vegetative protein 147; VEG147; EC 1.1.1.- from Bacillus subtilis (strain 168) (see paper)
25% identity, 94% coverage: 1:320/339 of query aligns to 1:303/310 of P46336
1pz0A Structure of NADPH-dependent family 11 aldo-keto reductase akr11a(holo) (see paper)
25% identity, 96% coverage: 5:330/339 of query aligns to 4:310/311 of 1pz0A
1ynqB Aldo-keto reductase akr11c1 from bacillus halodurans (holo form) (see paper)
29% identity, 91% coverage: 1:308/339 of query aligns to 2:269/298 of 1ynqB
1ynpB Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
29% identity, 91% coverage: 1:308/339 of query aligns to 2:269/298 of 1ynpB
3erpA Structure of idp01002, a putative oxidoreductase from and essential gene of salmonella typhimurium (see paper)
28% identity, 89% coverage: 1:303/339 of query aligns to 12:284/312 of 3erpA
1ynpA Aldo-keto reductase akr11c1 from bacillus halodurans (apo form) (see paper)
28% identity, 91% coverage: 1:308/339 of query aligns to 2:254/283 of 1ynpA
Sites not aligning to the query:
5t79A X-ray crystal structure of a novel aldo-keto reductases for the biocatalytic conversion of 3-hydroxybutanal to 1,3-butanediol (see paper)
28% identity, 89% coverage: 1:303/339 of query aligns to 13:289/315 of 5t79A
P77256 NADH-specific methylglyoxal reductase; AKR11B2; EC 1.1.1.- from Escherichia coli (strain K12) (see paper)
27% identity, 91% coverage: 1:307/339 of query aligns to 1:302/326 of P77256
8hw0A The structure of akr6d1
25% identity, 91% coverage: 1:307/339 of query aligns to 1:298/329 of 8hw0A
6ow0B Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
26% identity, 91% coverage: 1:308/339 of query aligns to 1:274/301 of 6ow0B
6hg6A Clostridium beijerinckii aldo-keto reductase cbei_3974 with NADPH (see paper)
26% identity, 91% coverage: 1:307/339 of query aligns to 12:291/313 of 6hg6A
4aubB The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
25% identity, 96% coverage: 1:325/339 of query aligns to 11:320/335 of 4aubB
Sites not aligning to the query:
6ow0A Crystal structure of mithramycin 3-side chain keto-reductase mtmw in complex with NAD+ and peg (see paper)
25% identity, 91% coverage: 1:308/339 of query aligns to 1:298/323 of 6ow0A
3n6qD Crystal structure of yghz from e. Coli (see paper)
25% identity, 96% coverage: 1:325/339 of query aligns to 12:307/315 of 3n6qD
4aubE The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
26% identity, 91% coverage: 1:308/339 of query aligns to 12:277/297 of 4aubE
Sites not aligning to the query:
4aubF The complex structure of the bacterial aldo-keto reductase akr14a1 with NADP and citrate (see paper)
25% identity, 96% coverage: 1:325/339 of query aligns to 11:297/298 of 4aubF
Q3L181 Perakine reductase; EC 1.1.1.317 from Rauvolfia serpentina (Serpentine wood) (Ophioxylon serpentinum) (see paper)
24% identity, 94% coverage: 1:318/339 of query aligns to 1:301/337 of Q3L181
>SMc02775 FitnessBrowser__Smeli:SMc02775
MQTRRIGRTALAVTEYSFGTAGLGGLYRECTREAAMATLDAAWEAGIRYFDTAPFYGLGL
AERRVGDFLRDKPRDSFVLSTKVGRLLHPVPENQVPDYSYVKPLNFDVTYDYGYDAIMRS
VEMSYARLGLNRIDILYVHDIGGYTHGAAKNAVYLRQLLDSGLKALDELKSSGVISAYGL
GVNEVPVCLDVMRQADIDCILLAGRYTLLDRSAVAELLPLCAKKDTSLVVGGVFNSGILA
TGPVEGAHFDYMPATGEVRAKVAAMERIAGERGMPLAAPALQFPLANPHVASVLLGTAKP
SSLTRNMELTRYGIAPEDYAAFEPHTLVAPELGPEAVRA
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory