Comparing SMc03063 FitnessBrowser__Smeli:SMc03063 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 4 hits to proteins with known functional sites (download)
P94530 Arabinooligosaccharides transport system permease protein AraQ from Bacillus subtilis (strain 168) (see paper)
31% identity, 62% coverage: 146:379/380 of query aligns to 55:281/281 of P94530
P68183 Maltose/maltodextrin transport system permease protein MalG from Escherichia coli (strain K12) (see 2 papers)
31% identity, 56% coverage: 169:379/380 of query aligns to 87:296/296 of P68183
P02916 Maltose/maltodextrin transport system permease protein MalF from Escherichia coli (strain K12) (see 4 papers)
23% identity, 62% coverage: 93:326/380 of query aligns to 204:455/514 of P02916
4ki0F Crystal structure of the maltose-binding protein/maltose transporter complex in an outward-facing conformation bound to maltohexaose (see paper)
25% identity, 46% coverage: 153:326/380 of query aligns to 248:440/490 of 4ki0F
>SMc03063 FitnessBrowser__Smeli:SMc03063
MNPSRRSPLTWAVHLSVLLLVLLWTLPTAGLLISSLRDKDQLAVSGWWTALSSSSRNAVV
RAPSAEDQVERDGKFVISGNLLEGRGEVSAFGFSSREPTKFKPGETAELNDGERLTVQSD
GSFEIVSDQRMEGSRGQRIFFTATTPPRFTLDNYAEVLSAAGIGRSFLNSLTVAVPSTVI
PILIAAFAAYALAWMPFPGRAVLLAVVVGLLVVPLQMSLIPLLQLYNGVGAFFGVSAKTY
MGIWLAHTGFGLPLAIYLLRNYMAGLPREIMESARVDGASDFDIFVKIILPLSFPALASF
AIFQFLWTWNDLLVAIVFLGAGDDKLVLTGRLVNLLGSRGGNWEILTASAFITIVVPLIV
FFALQRYLVRGLLAGSVKGG
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory