SitesBLAST
Comparing SMc03138 FitnessBrowser__Smeli:SMc03138 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1v1bA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound atp (see paper)
31% identity, 89% coverage: 21:261/270 of query aligns to 27:286/300 of 1v1bA
- active site: G248 (= G223), A249 (= A224), G250 (= G225), D251 (= D226)
- binding adenosine-5'-triphosphate: K219 (≠ T194), G221 (= G196), A238 (≠ G212), F239 (≠ I213), V241 (= V216), G248 (= G223), A249 (= A224), G250 (= G225), N275 (≠ R250), A279 (= A254)
1v1aA 2-keto-3-deoxygluconate kinase from thermus thermophilus with bound 2- keto-3-deoxygluconate and adp (see paper)
31% identity, 89% coverage: 21:261/270 of query aligns to 27:286/301 of 1v1aA
- active site: G248 (= G223), A249 (= A224), G250 (= G225), D251 (= D226)
- binding adenosine-5'-diphosphate: K219 (≠ T194), G221 (= G196), A222 (= A197), A249 (= A224), G250 (= G225), N275 (≠ R250), A279 (= A254)
- binding 2-keto-3-deoxygluconate: G34 (= G28), A35 (≠ N29), N38 (= N32), Y89 (≠ T83), R105 (≠ E98), R167 (≠ N151), G248 (= G223), D251 (= D226)
Sites not aligning to the query:
Q53W83 2-dehydro-3-deoxygluconokinase; 2-keto-3-deoxygluconokinase; 3-deoxy-2-oxo-D-gluconate kinase; KDG kinase; EC 2.7.1.45 from Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) (see paper)
31% identity, 89% coverage: 21:261/270 of query aligns to 27:286/309 of Q53W83
- GAEVN 34:38 (≠ GNAIN 28:32) binding
- YYR 103:105 (≠ VHE 96:98) binding
- R167 (≠ N151) binding
- S193 (= S168) binding
- 219:225 (vs. 194:200, 57% identical) binding
- GAGD 248:251 (= GAGD 223:226) binding
- D251 (= D226) binding
- N275 (≠ R250) binding
Sites not aligning to the query:
2c49A Crystal structure of methanocaldococcus jannaschii nucleoside kinase - an archaeal member of the ribokinase family (see paper)
29% identity, 84% coverage: 18:245/270 of query aligns to 31:264/299 of 2c49A
- active site: G242 (= G223), A243 (= A224), G244 (= G225), D245 (= D226)
- binding adenosine: G40 (= G27), G41 (= G28), N45 (= N32), A97 (≠ G91), T109 (vs. gap), F111 (vs. gap), Q161 (= Q146), D162 (= D147), D245 (= D226)
- binding phosphoaminophosphonic acid-adenylate ester: Q107 (vs. gap), N184 (≠ S168), T212 (= T194), G214 (= G196), G217 (= G199), C231 (≠ G212), T241 (= T222), A243 (= A224)
Sites not aligning to the query:
Q57849 Nucleoside kinase; NK; ATP-dependent nucleoside monophosphokinase; Cytidine kinase; Guanosine-inosine kinase; EC 2.7.1.213; EC 2.7.1.73 from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii) (see paper)
29% identity, 84% coverage: 18:245/270 of query aligns to 33:266/302 of Q57849
- Q33 (≠ R18) binding
- G43 (= G28) binding
- N47 (= N32) binding
- Q109 (vs. gap) binding
- TFF 111:113 (vs. gap) binding
- Q163 (= Q146) binding
- N186 (≠ S168) binding
- TKGSKG 214:219 (≠ TRGALG 194:199) binding
- D247 (= D226) binding
Sites not aligning to the query:
- 1 modified: Initiator methionine, Removed
- 17 binding
3uboA The crystal structure of adenosine kinase from sinorhizobium meliloti
29% identity, 94% coverage: 12:264/270 of query aligns to 35:315/338 of 3uboA
- active site: R124 (= R93), G274 (= G223), A275 (= A224), G276 (= G225), D277 (= D226)
- binding adenosine: G57 (vs. gap), G58 (= G28), S59 (≠ N29), N62 (= N32), M126 (≠ V96), T128 (≠ E98), E155 (vs. gap), Y157 (≠ W126), G274 (= G223), D277 (= D226), P313 (≠ G262)
- binding adenosine-5'-diphosphate: N214 (≠ S168), T244 (= T194), S246 (≠ G196), E247 (≠ A197), G249 (= G199), L266 (≠ V216), A275 (= A224), G276 (= G225), N301 (≠ R250), A304 (= A253), I308 (≠ C257)
Sites not aligning to the query:
7fcaD Pfkb(mycobacterium marinum) (see paper)
30% identity, 83% coverage: 9:233/270 of query aligns to 7:237/282 of 7fcaD
A1A6H3 Ribokinase; AtRBSK; RK; EC 2.7.1.15 from Arabidopsis thaliana (Mouse-ear cress) (see paper)
26% identity, 91% coverage: 23:267/270 of query aligns to 101:366/379 of A1A6H3
Sites not aligning to the query:
- 1:74 mutation Missing: Loss of ribokinase activity.
6ilsB Structure of arabidopsis thaliana ribokinase complexed with ribose and atp (see paper)
26% identity, 91% coverage: 23:267/270 of query aligns to 35:300/313 of 6ilsB
- binding adenosine-5'-triphosphate: N189 (≠ D172), K225 (≠ S200), G227 (≠ A202), I246 (= I213), A248 (= A215), A257 (= A224), G258 (= G225), F261 (= F228), A286 (= A254), S287 (≠ D255)
- binding alpha-D-ribofuranose: G40 (= G28), K41 (≠ N29), N44 (= N32), E144 (≠ T118), D259 (= D226)
Sites not aligning to the query:
4k8pA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-ethylbenzyl alcohol
28% identity, 94% coverage: 12:264/270 of query aligns to 38:318/332 of 4k8pA
- active site: R127 (= R93), G277 (= G223), A278 (= A224), G279 (= G225), D280 (= D226)
- binding (2-ethylphenyl)methanol: A45 (= A19), Y49 (≠ Q23), R116 (≠ Y82)
- binding adenosine: G60 (vs. gap), G61 (= G28), S62 (≠ N29), N65 (= N32), M129 (≠ V96), T131 (≠ E98), E158 (vs. gap), Y160 (≠ W126), T276 (= T222), D280 (= D226), P316 (≠ G262)
Sites not aligning to the query:
4lc4A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with guanosine
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4lc4A
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
- binding guanosine: T245 (= T194), S247 (≠ G196), E248 (≠ A197), A305 (= A253), I309 (≠ C257)
Sites not aligning to the query:
4kbeA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with benzoguanamine
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4kbeA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), D278 (= D226), P314 (≠ G262)
- binding 6-phenyl-1,3,5-triazine-2,4-diamine: P52 (vs. gap), A53 (vs. gap), L54 (vs. gap)
Sites not aligning to the query:
4kanA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 2-(2,5-dimethyl-1,3-thiazol-4-yl)acetic acid
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4kanA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
- binding (2,5-dimethyl-1,3-thiazol-4-yl)acetic acid: A43 (= A19), E44 (≠ P20), Y47 (≠ Q23), R114 (≠ Y82), M116 (≠ D84), N215 (≠ G170), T245 (= T194), S247 (≠ G196), A276 (= A224)
Sites not aligning to the query:
4kalA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with quinoline-3-carboxylic acid
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4kalA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226)
- binding quinoline-3-carboxylic acid: S190 (vs. gap), F191 (vs. gap), D194 (vs. gap), S221 (≠ A176), Q224 (≠ L179)
Sites not aligning to the query:
4kahA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with 4-bromo-1h-pyrazole
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4kahA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
- binding 4-bromo-1H-pyrazole: Y47 (≠ Q23), L86 (≠ D55)
Sites not aligning to the query:
4kadA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n1-(2.3-dihydro-1h-inden-5-yl)acetam
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4kadA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding N-(4,7-dihydro-1H-inden-6-yl)acetamide: S247 (≠ G196), E248 (≠ A197), A305 (= A253), I309 (≠ C257)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226)
Sites not aligning to the query:
4k9iA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with norharmane
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4k9iA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226)
- binding Norharmane: S190 (vs. gap), F191 (vs. gap), D194 (vs. gap), Q224 (≠ L179)
Sites not aligning to the query:
4k9cA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide and 4-methyl-3,4- dihydro-2h-1,4-benzoxazine-7-carboxylic acid
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4k9cA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding N-(hydroxymethyl)benzamide: Y47 (≠ Q23), Q85 (≠ S54), L86 (≠ D55), D88 (≠ A57), P111 (vs. gap), R114 (≠ Y82)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
- binding 4-methyl-3,4-dihydro-2H-1,4-benzoxazine-7-carboxylic acid: S190 (vs. gap), F191 (vs. gap), D194 (vs. gap), Q224 (≠ L179)
Sites not aligning to the query:
4k93A Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with n-(hydroxymethyl)benzamide
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4k93A
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding N-(hydroxymethyl)benzamide: L37 (≠ C13), I38 (= I14), Y47 (≠ Q23), Q85 (≠ S54), D88 (≠ A57), R114 (≠ Y82), L131 (≠ F100), D161 (= D129), S190 (vs. gap), F191 (vs. gap), D194 (vs. gap), R197 (vs. gap), L220 (≠ S175), S221 (≠ A176), Q224 (≠ L179), D226 (≠ G181), R234 (vs. gap)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
Sites not aligning to the query:
4k8tA Crystal structure of probable sugar kinase protein from rhizobium etli cfn 42 complexed with ethyl 3,4-diaminobenzoate
28% identity, 94% coverage: 12:264/270 of query aligns to 36:316/330 of 4k8tA
- active site: R125 (= R93), G275 (= G223), A276 (= A224), G277 (= G225), D278 (= D226)
- binding adenosine: G58 (vs. gap), G59 (= G28), S60 (≠ N29), N63 (= N32), M127 (≠ V96), T129 (≠ E98), E156 (vs. gap), Y158 (≠ W126), T274 (= T222), D278 (= D226), P314 (≠ G262)
- binding ethyl 3,4-diaminobenzoate: F109 (vs. gap), P111 (vs. gap), R114 (≠ Y82), Y130 (≠ D99)
Sites not aligning to the query:
Query Sequence
>SMc03138 FitnessBrowser__Smeli:SMc03138
MTSFRFAAVGDNCIDRYRAPLRQSYVGGNAINVAVQLARLGHGSFYFGAVGRDSDGAQVR
RLLLANGVNVDHLLARDTNTAYTDIDVTPAGDRIFVHEDFGACAGYRPDAGEIELLKTMD
HVHIGWLDDGGLLRRALSAAGVSVSQDVSVNAAAADLEVDGLSIAFGSAGEDETSAERLT
GEFLARGARLAVVTRGALGSLASDGAEVASAGIRAVEVVDTTGAGDSFIAGFIAARLEGR
ALAACLEAGRDLAADTCTHVGGFPQEPQSI
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory