Comparing SMc03206 FitnessBrowser__Smeli:SMc03206 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1fw1A Glutathione transferase zeta/maleylacetoacetate isomerase (see paper)
46% identity, 94% coverage: 10:214/217 of query aligns to 3:202/208 of 1fw1A
O43708 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Homo sapiens (Human) (see 10 papers)
45% identity, 96% coverage: 6:214/217 of query aligns to 3:206/216 of O43708
Q9WVL0 Maleylacetoacetate isomerase; MAAI; GSTZ1-1; Glutathione S-transferase zeta 1; EC 5.2.1.2; EC 2.5.1.18 from Mus musculus (Mouse)
43% identity, 96% coverage: 6:214/217 of query aligns to 3:206/216 of Q9WVL0
2cz2A Crystal structure of glutathione transferase zeta 1-1 (maleylacetoacetate isomerase) from mus musculus (form-1 crystal)
43% identity, 94% coverage: 10:214/217 of query aligns to 4:203/212 of 2cz2A
2v6kA Structure of maleyl pyruvate isomerase, a bacterial glutathione-s- transferase in zeta class, in complex with substrate analogue dicarboxyethyl glutathione (see paper)
46% identity, 93% coverage: 11:212/217 of query aligns to 5:207/214 of 2v6kA
2jl4A Holo structure of maleyl pyruvate isomerase, a bacterial glutathione- s-transferase in zeta class (see paper)
46% identity, 93% coverage: 11:212/217 of query aligns to 3:205/212 of 2jl4A
O86043 Maleylpyruvate isomerase; MPI; Naphthalene degradation protein L; EC 5.2.1.4 from Ralstonia sp. (see paper)
46% identity, 93% coverage: 11:212/217 of query aligns to 3:205/212 of O86043
4kdyA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound gsh in the active site
45% identity, 94% coverage: 11:214/217 of query aligns to 12:210/222 of 4kdyA
4kaeA Crystal structure of maleylacetoacetate isomerase from anaeromyxobacter dehalogenans 2cp-1, target efi-507175, with bound dicarboxyethyl glutathione and citrate in the active site
45% identity, 94% coverage: 11:214/217 of query aligns to 10:208/220 of 4kaeA
4pxoA Crystal structure of maleylacetoacetate isomerase from methylobacteriu extorquens am1 with bound malonate and gsh (target efi-507068)
44% identity, 94% coverage: 11:214/217 of query aligns to 5:210/216 of 4pxoA
D2YW48 Probable glutathione S-transferase; EC 2.5.1.18 from Coccidioides immitis (strain RS) (Valley fever fungus)
36% identity, 93% coverage: 11:211/217 of query aligns to 8:218/231 of D2YW48
3n5oA Crystal structure of putative glutathione transferase from coccidioides immitis bound to glutathione (see paper)
36% identity, 93% coverage: 11:211/217 of query aligns to 6:216/228 of 3n5oA
4chsA Crystal structure of a tau class glutathione transferase 10 from glycine max (see paper)
30% identity, 97% coverage: 6:216/217 of query aligns to 1:203/215 of 4chsA
3m3mA Crystal structure of glutathione s-transferase from pseudomonas fluorescens [pf-5]
28% identity, 88% coverage: 11:201/217 of query aligns to 5:190/201 of 3m3mA
5agyA Crystal structure of a tau class gst mutant from glycine (see paper)
29% identity, 98% coverage: 5:216/217 of query aligns to 1:204/219 of 5agyA
Sites not aligning to the query:
5j4uA Crystal structure of a glutathione s-transferase ptgstu30 from populus trichocarpa in complex with gsh
27% identity, 97% coverage: 6:216/217 of query aligns to 1:203/218 of 5j4uA
5f06A Crystal structure of glutathione transferase f7 from populus trichocarpa (see paper)
27% identity, 78% coverage: 11:179/217 of query aligns to 4:174/213 of 5f06A
3zmkB Anopheles funestus glutathione-s-transferase epsilon 2 (gste2) protein structure from different alelles: a single amino acid change confers high level of ddt resistance and cross resistance to permethrin in a major malaria vector in africa (see paper)
28% identity, 78% coverage: 10:178/217 of query aligns to 7:168/222 of 3zmkB
4ielB Crystal structure of a glutathione s-transferase family protein from burkholderia ambifaria, target efi-507141, with bound glutathione
32% identity, 76% coverage: 20:184/217 of query aligns to 9:171/206 of 4ielB
Sites not aligning to the query:
4pnfB Glutathione s-transferase from drosophila melanogaster - isozyme e6 (see paper)
39% identity, 36% coverage: 23:100/217 of query aligns to 17:95/221 of 4pnfB
Sites not aligning to the query:
>SMc03206 FitnessBrowser__Smeli:SMc03206
METGVANETVLYDYWRSSASYRVRIALNLCGEAYRSVPVDLLAKAHRAPEHLARNPQGLV
PVLDIDGERLTQSLAIIEYLAETRDGTGLLPAHPIDRQRVRALSYAVAMDIHPVCNLGVV
ARVMAGAGDGEAARREWMQKFIGEGLAAFERMLDHPATGAFCHGDRPTMADLCLVPQVYN
ARRWDVDLAACPLLVAIDRRCAGIDAFQRAHPDRAKP
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory