SitesBLAST
Comparing SMc04123 FitnessBrowser__Smeli:SMc04123 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
4uc0A Crystal structure of a purine nucleoside phosphorylase (psi-nysgrc- 029736) from agrobacterium vitis
64% identity, 99% coverage: 4:265/265 of query aligns to 2:245/247 of 4uc0A
- active site: S23 (= S25), H68 (= H78), Y70 (= Y80), E71 (= E81), A98 (≠ S108), M193 (= M203), S194 (= S204), N217 (= N227), G219 (≠ A229)
- binding hypoxanthine: A99 (= A109), G100 (= G110), F174 (= F184), E175 (= E185), G192 (= G202), M193 (= M203), T216 (= T226), N217 (= N227)
3odgA Crystal structure of xanthosine phosphorylase bound with xanthine from yersinia pseudotuberculosis
46% identity, 94% coverage: 17:264/265 of query aligns to 22:272/273 of 3odgA
- active site: S30 (= S25), H61 (= H56), H83 (= H78), Y85 (= Y80), E86 (= E81), A113 (≠ S108), M211 (= M203), S212 (= S204), N235 (= N227), A237 (= A229), H247 (= H239)
- binding xanthine: A114 (= A109), G115 (= G110), F192 (= F184), E193 (= E185), G210 (= G202), M211 (= M203), T234 (= T226), N235 (= N227)
8swuA Structure of clostridium perfringens pnp bound to transition state analog immucillin h and sulfate (see paper)
46% identity, 93% coverage: 1:246/265 of query aligns to 8:251/269 of 8swuA
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: Y82 (= Y80), A110 (≠ S108), A111 (= A109), G112 (= G110), Y189 (≠ F184), E190 (= E185), M208 (= M203), N232 (= N227), H244 (= H239), V247 (≠ T242)
P46354 Purine nucleoside phosphorylase 1; PNP 1; Inosine phosphorylase; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase I; PNP I; Pu-NPase I; EC 2.4.2.1 from Bacillus subtilis (strain 168) (see paper)
46% identity, 91% coverage: 4:245/265 of query aligns to 8:251/271 of P46354
- S28 (= S25) modified: Phosphoserine
P45563 Purine nucleoside phosphorylase 2; Inosine-guanosine phosphorylase; Purine nucleoside phosphorylase II; PNP II; Xanthosine phosphorylase; EC 2.4.2.1 from Escherichia coli (strain K12) (see paper)
45% identity, 92% coverage: 6:248/265 of query aligns to 15:260/277 of P45563
- H65 (= H56) binding
- RGH 85:87 (≠ RAH 76:78) binding
- A117 (≠ S108) binding
- Y191 (≠ F179) mutation to L: No detectable activity with xanthosine as substrate, but largely retains its activity against other substrates, namely inosine and guanosine, although with altered affinities, higher and lower respectively, and clearly reduced maximal velocities for both.
- E197 (= E185) binding
- S216 (= S204) binding
- N239 (= N227) binding ; mutation to D: Catalyzes the phosphorolysis of adenosine with moderate efficiency, and essentially has lost all activity against the 6-oxo-purine substrates xanthosine, inosine and guanosine.
1yr3A Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
45% identity, 92% coverage: 6:248/265 of query aligns to 11:256/273 of 1yr3A
- active site: S30 (= S25), H61 (= H56), H83 (= H78), Y85 (= Y80), E86 (= E81), A113 (≠ S108), M211 (= M203), S212 (= S204), N235 (= N227), A237 (= A229), H247 (= H239)
- binding xanthine: A114 (= A109), E193 (= E185), G210 (= G202), N235 (= N227)
1yqqA Escherichia coli purine nucleoside phosphorylase ii, the product of the xapa gene (see paper)
45% identity, 92% coverage: 6:248/265 of query aligns to 11:256/273 of 1yqqA
- active site: S30 (= S25), H61 (= H56), H83 (= H78), Y85 (= Y80), E86 (= E81), A113 (≠ S108), M211 (= M203), S212 (= S204), N235 (= N227), A237 (= A229), H247 (= H239)
- binding guanine: A114 (= A109), G115 (= G110), E193 (= E185), G210 (= G202), M211 (= M203), T234 (= T226), N235 (= N227), T250 (= T242)
- binding phosphate ion: H61 (= H56), R81 (= R76), H83 (= H78), N112 (= N107), S212 (= S204)
8swtA Structure of bacteroides fragilis pnp bound to transition state analog immucillin h and sulfate (see paper)
39% identity, 98% coverage: 4:262/265 of query aligns to 17:276/278 of 8swtA
- binding 1,4-dideoxy-4-aza-1-(s)-(9-deazahypoxanthin-9-yl)-d-ribitol: H90 (= H78), Y92 (= Y80), A120 (≠ S108), S121 (≠ A109), G122 (= G110), F198 (= F184), E199 (= E185), Y204 (≠ I190), G216 (= G202), M217 (= M203), D241 (≠ N227), H253 (= H239)
3lbaA The crystal structure of smu.1229 from streptococcus mutans ua159 bound to hypoxanthine
45% identity, 88% coverage: 6:238/265 of query aligns to 12:237/260 of 3lbaA
- active site: S30 (= S25), H77 (= H78), Y79 (= Y80), E80 (= E81), A107 (≠ S108), M203 (= M203), S204 (= S204), N227 (= N227), A229 (= A229)
- binding hypoxanthine: A107 (≠ S108), A108 (= A109), G109 (= G110), Y184 (≠ F184), E185 (= E185), V201 (= V201), G202 (= G202), N227 (= N227)
4m1eB Crystal structure of purine nucleoside phosphorylase i from planctomyces limnophilus dsm 3776, nysgrc target 029364.
38% identity, 92% coverage: 17:261/265 of query aligns to 22:269/273 of 4m1eB
- active site: T30 (≠ S25), H61 (= H56), H83 (= H78), Y85 (= Y80), E86 (= E81), A113 (≠ S108), M211 (= M203), S212 (= S204), D235 (≠ N227), C237 (≠ A229), L247 (≠ H239)
- binding pyridine-2-carboxylic acid: N118 (≠ R113), Q120 (≠ D115), R169 (≠ E161), H178 (≠ P170), P180 (≠ A172), P180 (≠ A172)
- binding adenine: A114 (= A109), G115 (= G110), E193 (= E185), V209 (= V201), D235 (≠ N227)
P9WP01 Purine nucleoside phosphorylase; PNP; Pu-NPase; Inosine phosphorylase; Inosine-guanosine phosphorylase; EC 2.4.2.1 from Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 15:266/268 of P9WP01
1i80A Crystal structure of m. Tuberculosis pnp in complex with iminoribitol, 9-deazahypoxanthine and phosphate ion (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 13:264/266 of 1i80A
- active site: S34 (= S25), H66 (= H56), H88 (= H78), Y90 (= Y80), E91 (= E81), A118 (≠ S108), M205 (= M203), S206 (= S204), N229 (= N227), A231 (= A229), H241 (= H239)
- binding 9-deazahypoxanthine: A118 (≠ S108), A119 (= A109), G120 (= G110), E187 (= E185), V203 (= V201), G204 (= G202), M205 (= M203), N229 (= N227)
- binding iminoribitol: S34 (= S25), Y90 (= Y80), Y186 (≠ F184), M205 (= M203), H241 (= H239)
- binding phosphate ion: G33 (= G24), S34 (= S25), R86 (= R76), H88 (= H78), N117 (= N107), A118 (≠ S108), S206 (= S204)
3sczA Combining crystallographic, thermodynamic, and molecular dynamics studies of mycobacterium tuberculosis purine nucleoside phosphorylase
42% identity, 98% coverage: 4:262/265 of query aligns to 10:261/263 of 3sczA
- active site: S31 (= S25), H63 (= H56), H85 (= H78), Y87 (= Y80), E88 (= E81), A115 (≠ S108), M202 (= M203), S203 (= S204), N226 (= N227), A228 (= A229), H238 (= H239)
- binding hypoxanthine: G117 (= G110), Y183 (≠ F184), E184 (= E185), G201 (= G202), M202 (= M203), N226 (= N227)
7zsqC Human purine nucleoside phosphorylase in complex with js-555 (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 15:266/268 of 7zsqC
- binding [2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenoxy]methylphosphonic acid: G35 (= G24), S36 (= S25), R88 (= R76), H90 (= H78), Y92 (= Y80), N119 (= N107), A120 (≠ S108), A121 (= A109), G122 (= G110), Y188 (≠ F184), E189 (= E185), V205 (= V201), M207 (= M203), S208 (= S204), N231 (= N227)
4nsnA Crystal structure of purine nucleoside phosphorylase from porphyromonas gingivalis atcc 33277, nysgrc target 030972, orthorhombic symmetry
40% identity, 98% coverage: 4:263/265 of query aligns to 11:272/273 of 4nsnA
- active site: S31 (= S25), H62 (= H56), H84 (= H78), Y86 (= Y80), E87 (= E81), A114 (≠ S108), M211 (= M203), S212 (= S204), N235 (= N227), E248 (= E236)
- binding adenine: A114 (≠ S108), A115 (= A109), G116 (= G110), Y192 (≠ F184), E193 (= E185), Y198 (≠ I190), G210 (= G202), M211 (= M203), T234 (= T226), N235 (= N227)
7zsqB Human purine nucleoside phosphorylase in complex with js-555 (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 9:260/261 of 7zsqB
- binding [2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenoxy]methylphosphonic acid: S30 (= S25), R82 (= R76), H84 (= H78), Y86 (= Y80), N113 (= N107), A114 (≠ S108), A115 (= A109), G116 (= G110), Y182 (≠ F184), E183 (= E185), V199 (= V201), M201 (= M203), S202 (= S204), N225 (= N227)
- binding polyethylene glycol: L136 (≠ F130), M190 (= M192)
- binding 6-tungstotellurate(VI): G145 (≠ L139), F147 (= F145)
8c25A Purine nucleoside phosphorylase in complex with js-375 (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 9:260/262 of 8c25A
- binding [(~{E})-2-[4-methoxy-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid: G29 (= G24), S30 (= S25), R82 (= R76), H84 (= H78), Y86 (= Y80), N113 (= N107), A114 (≠ S108), A115 (= A109), G116 (= G110), Y182 (≠ F184), E183 (= E185), V199 (= V201), M201 (= M203), S202 (= S204), T224 (= T226), N225 (= N227), H237 (= H239)
7zsrA Purine nucleoside phosphorylase in complex with js-379 (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 9:260/262 of 7zsrA
- binding [(~{E})-2-[5-bromanyl-2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenyl]ethenyl]phosphonic acid: G29 (= G24), S30 (= S25), R82 (= R76), H84 (= H78), N113 (= N107), A114 (≠ S108), A115 (= A109), G116 (= G110), Y182 (≠ F184), E183 (= E185), V199 (= V201), M201 (= M203), S202 (= S204), T224 (= T226), N225 (= N227)
7zsqA Human purine nucleoside phosphorylase in complex with js-555 (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 9:260/262 of 7zsqA
- binding [2-[(4-oxidanylidene-3,5-dihydropyrrolo[3,2-d]pyrimidin-7-yl)sulfanyl]phenoxy]methylphosphonic acid: G29 (= G24), S30 (= S25), R82 (= R76), H84 (= H78), N113 (= N107), A114 (≠ S108), A115 (= A109), G116 (= G110), Y182 (≠ F184), E183 (= E185), V199 (= V201), M201 (= M203), S202 (= S204), N225 (= N227), H237 (= H239)
- binding 6-tungstotellurate(VI): S30 (= S25), H62 (= H56), R82 (= R76), H84 (= H78), Y86 (= Y80), H237 (= H239)
3ix2A Crystal structure of purine nucleoside phosphorylase from mycobacterium tuberculosis in complex with acyclovir (see paper)
42% identity, 98% coverage: 4:262/265 of query aligns to 9:260/262 of 3ix2A
- binding 9-hyroxyethoxymethylguanine: A114 (≠ S108), A115 (= A109), G116 (= G110), Y182 (≠ F184), E183 (= E185), V199 (= V201), G200 (= G202), M201 (= M203), T224 (= T226), N225 (= N227), L235 (= L237), V240 (≠ T242)
- binding phosphate ion: N113 (= N107), A114 (≠ S108), M201 (= M203), S202 (= S204)
Query Sequence
>SMc04123 FitnessBrowser__Smeli:SMc04123
MTGAADFLKGRLGAHAPRYGIVLGSGLGSLVDAVAEPLRIPYAEIPGFPVSSVSGHAGEF
VAGRIGDTPVAVLSGRAHYYERGDAKAMRVPIETLKRIGVENLILTNSAGSLREDMPPGS
VMRIADHIAFAGANPLIGLESDERFVGMTNAYDAALAIGMEEAAERLGIPLARGVYMWFS
GPSFETPAEIRMARILGADAVGMSTVPEVILARFFGLKVAAASVVTNFAAGMTGSELSHE
ETKQMAPLGGTRLAAILKEMISSEG
Or try a new SitesBLAST search
SitesBLAST's Database
SitesBLAST's database includes
(1) SwissProt
entries with experimentally-supported functional features;
and (2) protein structures with bound ligands, from the
BioLip database.
by Morgan Price,
Arkin group
Lawrence Berkeley National Laboratory