Comparing SMc04148 FitnessBrowser__Smeli:SMc04148 to proteins with known functional sites using BLASTp with E ≤ 0.001.
Or try Sites on a Tree, PaperBLAST, Conserved Domains, or compare to all protein structures
Found 20 (the maximum) hits to proteins with known functional sites (download)
1worA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 48% coverage: 411:786/789 of query aligns to 2:362/362 of 1worA
1wopA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 48% coverage: 411:786/789 of query aligns to 2:362/362 of 1wopA
1wooA Crystal structure of t-protein of the glycine cleavage system (see paper)
31% identity, 48% coverage: 411:786/789 of query aligns to 2:362/362 of 1wooA
3a8iA Crystal structure of et-ehred-5-ch3-thf complex (see paper)
32% identity, 43% coverage: 411:747/789 of query aligns to 2:329/363 of 3a8iA
Q8GAI3 4-methylaminobutanoate oxidase (formaldehyde-forming); MABO; Demethylating gamma-N-methylaminobutyrate oxidase; Gamma-N-methylaminobutyrate oxidase 1; EC 1.5.3.19 from Paenarthrobacter nicotinovorans (Arthrobacter nicotinovorans) (see paper)
29% identity, 53% coverage: 371:788/789 of query aligns to 384:823/824 of Q8GAI3
Sites not aligning to the query:
1pj6A Crystal structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folic acid (see paper)
30% identity, 50% coverage: 397:788/789 of query aligns to 415:827/828 of 1pj6A
Sites not aligning to the query:
Q9AGP8 Dimethylglycine oxidase; DMGO; EC 1.5.3.10 from Arthrobacter globiformis (see 2 papers)
30% identity, 50% coverage: 397:788/789 of query aligns to 417:829/830 of Q9AGP8
Sites not aligning to the query:
1pj7A Structure of dimethylglycine oxidase of arthrobacter globiformis in complex with folinic acid (see paper)
30% identity, 50% coverage: 397:788/789 of query aligns to 414:826/827 of 1pj7A
Sites not aligning to the query:
3gsiA Crystal structure of d552a dimethylglycine oxidase mutant of arthrobacter globiformis in complex with tetrahydrofolate (see paper)
29% identity, 50% coverage: 397:788/789 of query aligns to 414:826/827 of 3gsiA
Sites not aligning to the query:
Q9UI17 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Homo sapiens (Human) (see 4 papers)
28% identity, 44% coverage: 436:786/789 of query aligns to 513:856/866 of Q9UI17
Sites not aligning to the query:
Q46337 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain P-1) (see 2 papers)
29% identity, 43% coverage: 446:786/789 of query aligns to 618:964/967 of Q46337
Sites not aligning to the query:
3ad7A Heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with methylthio acetate (see paper)
29% identity, 48% coverage: 411:786/789 of query aligns to 574:961/963 of 3ad7A
Sites not aligning to the query:
1vrqA Crystal structure of heterotetrameric sarcosine oxidase from corynebacterium sp. U-96 in complex with folinic acid (see paper)
29% identity, 48% coverage: 411:786/789 of query aligns to 574:961/963 of 1vrqA
Sites not aligning to the query:
Q50LF0 Sarcosine oxidase subunit alpha; Sarcosine oxidase subunit A; Sarcosine oxidase (5,10-methylenetetrahydrofolate-forming) subunit alpha; Tetrameric sarcosine oxidase subunit alpha; TSOX subunit alpha; EC 1.5.3.24 from Corynebacterium sp. (strain U-96) (see 2 papers)
29% identity, 48% coverage: 411:786/789 of query aligns to 575:962/965 of Q50LF0
Sites not aligning to the query:
2gagA Heteroteterameric sarcosine: structure of a diflavin metaloenzyme at 1.85 a resolution (see paper)
30% identity, 43% coverage: 446:786/789 of query aligns to 616:962/965 of 2gagA
Sites not aligning to the query:
Q63342 Dimethylglycine dehydrogenase, mitochondrial; ME2GLYDH; EC 1.5.8.4 from Rattus norvegicus (Rat) (see 2 papers)
28% identity, 44% coverage: 436:786/789 of query aligns to 506:849/857 of Q63342
Sites not aligning to the query:
4pabB Crystal structure of the precursor form of rat dmgdh complexed with tetrahydrofolate (see paper)
28% identity, 44% coverage: 436:786/789 of query aligns to 469:812/824 of 4pabB
Sites not aligning to the query:
3tfjA Dmsp-dependent demethylase from p. Ubique - with cofactor thf (see paper)
27% identity, 44% coverage: 426:773/789 of query aligns to 29:369/369 of 3tfjA
3tfiA Dmsp-dependent demethylase from p. Ubique - with substrate dmsp (see paper)
27% identity, 44% coverage: 426:773/789 of query aligns to 29:369/369 of 3tfiA
Q4FP21 Dimethylsulfonioproprionate demethylase DmdA; EC 2.1.1.269 from Pelagibacter ubique (strain HTCC1062) (see paper)
27% identity, 44% coverage: 426:773/789 of query aligns to 29:369/369 of Q4FP21
>SMc04148 FitnessBrowser__Smeli:SMc04148
MENRHPGMLGGRPVSASIIRYPGVPALPKDTERYRCKGGGSLVVRVEAGDLVTVTDAEGG
QACELSFVDESGRFQAAGLGAAFTNAAEGLKTILSREEAGTLRIRSALRRRGADLATAGA
LRIFGERSTPGSRVEFTIALKGLLIVAAPAEAMSPEAQDTATPIEVRVRRSRVVRDYSSA
LPEPLADPIEDIRIKAATASAYFVRAGEFIQIIDVYGRQCTDFQAFAARKVDKGLDLALD
STVTRTLLGRSYPAPGLPSKAFDRDFEPLVEIVQDTVGRHDAFATACNSRYYDDMGYPGH
VNCTDNFNAALAPYGIPGRKGWEALNYFYNTDIDHNNQLYLDEPWSRPGDYVLMRALTDL
VCVSSSCPDDIDAANGWDPTDIHVRTFSGKEQFSRAVAYRMTPDADPELTRETAFHPRFS
ALTRDYAEYRGYWLPNRFSSAGPVEEYWACRERAAVIDLSPLRKFEVTGPDAEELLQYCL
TRDVRKLSTGQVVYSAMCYEHGGMIDDGTLFRLGDKNFRWIGGDDYSGIWLREQAEKKGF
RAWVRSSTDQMHNIAVQGPKSRDILKEIVWTAPRQPTIGELEWFRFAVGRIGGFEGAPIV
VSRTGYTGELGYEIFCHPKDALTVFDAVWRAGEPHGLRPMGLEALDMVRIEAGLIFAHYD
FDDQTDPFEAGIGFTVPLKSKHDDFIGREALIRRKENPRHLMVGLDIQANEAVGHGDCVH
VGRAQIGVITSATRSPVLGKTIALARIDVTHATVGTQVEIGKLDGQQKRLPAIVVPLSHY
DPQKKRPRS
Or try a new SitesBLAST search
SitesBLAST's database includes (1) SwissProt entries with experimentally-supported functional features; and (2) protein structures with bound ligands, from the BioLip database.
Lawrence Berkeley National Laboratory